Index of /pub/php/manual/de

[ICO]NameLast modifiedSizeDescription

[PARENTDIR]Parent Directory  -  
[   ]search-description.json2024-06-13 02:01 1.5M 
[   ]search-index.json2024-06-13 02:01 1.3M 
[   ]indexes.functions.php2024-06-13 02:01 1.1M 
[   ]indexes.examples.php2024-06-13 02:01 710K 
[   ]class.intlchar.php2024-06-13 02:01 462K 
[   ]class.imagick.php2024-06-13 02:01 280K 
[   ]curl.constants.php2024-06-13 02:01 198K 
[   ]function.curl-setopt.php2024-06-13 02:01 172K 
[   ]event.examples.php2024-06-13 02:01 161K 
[   ]imagick.constants.php2024-06-13 02:01 158K 
[   ]resource.php2024-06-13 02:01 117K 
[   ]class.solrquery.php2024-06-13 02:01 116K 
[   ]class.solrdismaxquery.php2024-06-13 02:01 110K 
[   ]migration80.incompatible.php2024-06-13 02:01 104K 
[   ]ini.list.php2024-06-13 02:01 102K 
[   ]language.types.array.php2024-06-13 02:01 101K 
[   ]gmagick.constants.php2024-06-13 02:01 101K 
[   ]rpminfo.constants.php2024-06-13 02:01 96K 
[   ]class.ziparchive.php2024-06-13 02:01 89K 
[   ]class.gmagick.php2024-06-13 02:01 85K 
[   ]language.types.string.php2024-06-13 02:01 83K 
[   ]class.imagickdraw.php2024-06-13 02:01 81K 
[   ]mongodb-driver-manager.construct.php2024-06-13 02:01 79K 
[   ]solr.examples.php2024-06-13 02:01 78K 
[   ]function.oci-bind-by-name.php2024-06-13 02:01 78K 
[   ]sockets.constants.php2024-06-13 02:01 74K 
[   ]ini.core.php2024-06-13 02:01 73K 
[   ]class.numberformatter.php2024-06-13 02:01 73K 
[   ]class.phar.php2024-06-13 02:01 73K 
[   ]class.intlcalendar.php2024-06-13 02:01 71K 
[   ]intl.constants.php2024-06-13 02:01 68K 
[   ]class.domdocument.php2024-06-13 02:01 67K 
[   ]function.db2-set-option.php2024-06-13 02:01 66K 
[   ]imagick.morphology.php2024-06-13 02:01 65K 
[   ]function.oci-fetch-array.php2024-06-13 02:01 65K 
[   ]migration70.incompatible.php2024-06-13 02:01 64K 
[   ]mysqlnd.stats.php2024-06-13 02:01 63K 
[   ]book.imagick.php2024-06-13 02:01 62K 
[   ]radius.constants.attributes.php2024-06-13 02:01 60K 
[   ]function.strftime.php2024-06-13 02:01 58K 
[   ]datetime.formats.php2024-06-13 02:01 57K 
[   ]class.zookeeper.php2024-06-13 02:01 55K 
[   ]image.constants.php2024-06-13 02:01 54K 
[   ]class.intlgregoriancalendar.php2024-06-13 02:01 52K 
[   ]class.domelement.php2024-06-13 02:01 52K 
[   ]book.solr.php2024-06-13 02:01 52K 
[   ]opcache.configuration.php2024-06-13 02:01 52K 
[   ]language.oop5.basic.php2024-06-13 02:01 49K 
[   ]types.comparisons.php2024-06-13 02:01 49K 
[   ]class.rarentry.php2024-06-13 02:01 49K 
[   ]class.phardata.php2024-06-13 02:01 48K 
[   ]datetimeimmutable.createfromformat.php2024-06-13 02:01 48K 
[   ]session.configuration.php2024-06-13 02:01 47K 
[   ]class.memcached.php2024-06-13 02:01 46K 
[   ]soapclient.construct.php2024-06-13 02:01 46K 
[   ]win32service.constants.php2024-06-13 02:01 46K 
[   ]sqlsrv.constants.php2024-06-13 02:01 45K 
[   ]class.mysqli.php2024-06-13 02:01 45K 
[   ]zip.constants.php2024-06-13 02:01 44K 
[   ]tokens.php2024-06-13 02:01 44K 
[   ]pgsql.constants.php2024-06-13 02:01 44K 
[   ]book.intl.php2024-06-13 02:01 44K 
[   ]language.operators.bitwise.php2024-06-13 02:01 44K 
[   ]language.oop5.magic.php2024-06-13 02:01 43K 
[   ]mysqli.constants.php2024-06-13 02:01 43K 
[   ]functions.arguments.php2024-06-13 02:01 43K 
[   ]class.pdo.php2024-06-13 02:01 42K 
[   ]migration70.new-features.php2024-06-13 02:01 42K 
[   ]language.operators.comparison.php2024-06-13 02:01 42K 
[   ]language.types.declarations.php2024-06-13 02:01 42K 
[   ]class.ev.php2024-06-13 02:01 41K 
[   ]class.gender.php2024-06-13 02:01 41K 
[   ]ev.examples.php2024-06-13 02:01 41K 
[   ]class.xmlreader.php2024-06-13 02:01 40K 
[   ]filters.encryption.php2024-06-13 02:01 40K 
[   ]class.uconverter.php2024-06-13 02:01 40K 
[   ]class.zmq.php2024-06-13 02:01 39K 
[   ]pdo.constants.php2024-06-13 02:01 39K 
[   ]class.sqlite3.php2024-06-13 02:01 39K 
[   ]mysqli.summary.php2024-06-13 02:01 39K 
[   ]function.db2-connect.php2024-06-13 02:01 38K 
[   ]class.eventbufferevent.php2024-06-13 02:01 37K 
[   ]class.gearmanclient.php2024-06-13 02:01 37K 
[   ]function.curl-getinfo.php2024-06-13 02:01 37K 
[   ]mysqli.quickstart.prepared-statements.php2024-06-13 02:01 37K 
[   ]class.reflectionclass.php2024-06-13 02:01 37K 
[   ]book.swoole.php2024-06-13 02:01 36K 
[   ]class.splfileobject.php2024-06-13 02:01 36K 
[   ]book.reflection.php2024-06-13 02:01 36K 
[   ]install.fpm.configuration.php2024-06-13 02:01 36K 
[   ]class.collator.php2024-06-13 02:01 36K 
[   ]tidy.constants.php2024-06-13 02:01 35K 
[   ]function.oci-connect.php2024-06-13 02:01 35K 
[   ]oci8.examples.php2024-06-13 02:01 35K 
[   ]migration83.other-changes.php2024-06-13 02:01 35K 
[   ]soap.constants.php2024-06-13 02:01 35K 
[   ]language.oop5.traits.php2024-06-13 02:01 35K 
[   ]class.varnishlog.php2024-06-13 02:01 34K 
[   ]migration80.new-features.php2024-06-13 02:01 34K 
[   ]book.yaf.php2024-06-13 02:01 34K 
[   ]migration71.incompatible.php2024-06-13 02:01 34K 
[   ]eventbufferevent.sslfilter.php2024-06-13 02:01 34K 
[   ]class.soapclient.php2024-06-13 02:01 34K 
[   ]function.mb-decode-numericentity.php2024-06-13 02:01 33K 
[   ]function.imagefilter.php2024-06-13 02:01 33K 
[   ]ldap.constants.php2024-06-13 02:01 33K 
[   ]function.socket-get-option.php2024-06-13 02:01 33K 
[   ]class.domtext.php2024-06-13 02:01 33K 
[   ]mysqli.construct.php2024-06-13 02:01 33K 
[   ]class.domcharacterdata.php2024-06-13 02:01 33K 
[   ]mongodb-driver-query.construct.php2024-06-13 02:01 33K 
[   ]class.reflectionmethod.php2024-06-13 02:01 32K 
[   ]stream.constants.php2024-06-13 02:01 32K 
[   ]book.mysql-xdevapi.php2024-06-13 02:01 32K 
[   ]class.domnode.php2024-06-13 02:01 32K 
[   ]language.namespaces.faq.php2024-06-13 02:01 32K 
[   ]class.intldateformatter.php2024-06-13 02:01 32K 
[   ]function.db2-pconnect.php2024-06-13 02:01 32K 
[TXT]class.xmlwriter.php2024-06-13 02:01 31K 
[   ]pcntl.constants.php2024-06-13 02:01 31K 
[   ]class.domcdatasection.php2024-06-13 02:01 31K 
[   ]class.swoole-redis-server.php2024-06-13 02:01 31K 
[   ]function.create-function.php2024-06-13 02:01 31K 
[   ]migration72.constants.php2024-06-13 02:01 31K 
[   ]sodium.constants.php2024-06-13 02:01 31K 
[   ]class.spltempfileobject.php2024-06-13 02:01 31K 
[   ]class.filesystemiterator.php2024-06-13 02:01 31K 
[   ]function.json-encode.php2024-06-13 02:01 31K 
[   ]class.evloop.php2024-06-13 02:01 31K 
[   ]class.reflectionenum.php2024-06-13 02:01 31K 
[   ]pdostatement.fetch.php2024-06-13 02:01 31K 
[   ]class.ffi-ctype.php2024-06-13 02:01 31K 
[   ]string.constants.php2024-06-13 02:01 30K 
[   ]class.domcomment.php2024-06-13 02:01 30K 
[   ]function.array-udiff.php2024-06-13 02:01 30K 
[   ]mysqli.real-connect.php2024-06-13 02:01 30K 
[   ]class.intlbreakiterator.php2024-06-13 02:01 30K 
[   ]function.sprintf.php2024-06-13 02:01 29K 
[   ]imagick.examples-1.php2024-06-13 02:01 29K 
[   ]ref.pdo-cubrid.php2024-06-13 02:01 29K 
[   ]class.recursivedirectoryiterator.php2024-06-13 02:01 29K 
[   ]migration56.new-features.php2024-06-13 02:01 29K 
[   ]class.swoole-server.php2024-06-13 02:01 29K 
[   ]aliases.php2024-06-13 02:01 29K 
[   ]function.printf.php2024-06-13 02:01 29K 
[   ]intldateformatter.create.php2024-06-13 02:01 29K 
[   ]class.reflectionobject.php2024-06-13 02:01 29K 
[   ]language.oop5.decon.php2024-06-13 02:01 29K 
[   ]class.domdocumentfragment.php2024-06-13 02:01 28K 
[   ]function.win32-create-service.php2024-06-13 02:01 28K 
[   ]memcached.constants.php2024-06-13 02:01 28K 
[   ]class.locale.php2024-06-13 02:01 28K 
[   ]language.variables.scope.php2024-06-13 02:01 28K 
[   ]class.intltimezone.php2024-06-13 02:01 28K 
[   ]memcached.configuration.php2024-06-13 02:01 28K 
[   ]class.snmp.php2024-06-13 02:01 28K 
[   ]function.setcookie.php2024-06-13 02:01 28K 
[   ]class.domattr.php2024-06-13 02:01 28K 
[   ]function.oci-get-implicit-resultset.php2024-06-13 02:01 28K 
[   ]reserved.constants.php2024-06-13 02:01 28K 
[   ]language.exceptions.php2024-06-13 02:01 27K 
[   ]migration56.openssl.php2024-06-13 02:01 27K 
[   ]function.array-map.php2024-06-13 02:01 27K 
[   ]migration71.new-features.php2024-06-13 02:01 27K 
[   ]book.ui.php2024-06-13 02:01 27K 
[   ]language.oop5.properties.php2024-06-13 02:01 27K 
[   ]class.domentity.php2024-06-13 02:01 27K 
[   ]datetime.format.php2024-06-13 02:01 27K 
[   ]simplexml.examples-basic.php2024-06-13 02:01 27K 
[   ]function.usort.php2024-06-13 02:01 27K 
[   ]features.session.security.management.php2024-06-13 02:01 27K 
[   ]function.set-error-handler.php2024-06-13 02:01 27K 
[   ]mysqli-stmt.execute.php2024-06-13 02:01 27K 
[   ]class.domdocumenttype.php2024-06-13 02:01 27K 
[   ]function.mail.php2024-06-13 02:01 27K 
[   ]class.mongodb-driver-server.php2024-06-13 02:01 27K 
[   ]eio.examples.php2024-06-13 02:01 27K 
[   ]features.commandline.options.php2024-06-13 02:01 26K 
[   ]book.mongodb.php2024-06-13 02:01 26K 
[   ]faq.installation.php2024-06-13 02:01 26K 
[   ]imagick.sparsecolorimage.php2024-06-13 02:01 26K 
[   ]function.preg-match-all.php2024-06-13 02:01 26K 
[   ]migration82.other-changes.php2024-06-13 02:01 26K 
[   ]intldateformatter.format.php2024-06-13 02:01 26K 
[   ]language.types.type-juggling.php2024-06-13 02:01 26K 
[   ]class.globiterator.php2024-06-13 02:01 26K 
[   ]pdostatement.fetchall.php2024-06-13 02:01 26K 
[   ]class.swoole-http-server.php2024-06-13 02:01 26K 
[   ]function.db2-exec.php2024-06-13 02:01 26K 
[   ]com.constants.php2024-06-13 02:01 26K 
[   ]imagickkernel.frombuiltin.php2024-06-13 02:01 26K 
[   ]migration73.constants.php2024-06-13 02:01 26K 
[   ]class.sessionhandler.php2024-06-13 02:01 25K 
[   ]function.preg-replace.php2024-06-13 02:01 25K 
[   ]mysqli.quickstart.stored-procedures.php2024-06-13 02:01 25K 
[   ]class.mongodb-driver-cursor.php2024-06-13 02:01 25K 
[   ]function.db2-execute.php2024-06-13 02:01 25K 
[   ]function.oci-fetch-all.php2024-06-13 02:01 25K 
[   ]class.recursivetreeiterator.php2024-06-13 02:01 25K 
[   ]book.bson.php2024-06-13 02:01 25K 
[   ]class.eventutil.php2024-06-13 02:01 25K 
[   ]oci8.constants.php2024-06-13 02:01 25K 
[   ]migration81.new-features.php2024-06-13 02:01 25K 
[   ]filter.constants.php2024-06-13 02:01 25K 
[   ]mongodb-driver-manager.executecommand.php2024-06-13 02:01 25K 
[   ]parle.examples.parser.php2024-06-13 02:01 25K 
[   ]book.ds.php2024-06-13 02:01 25K 
[   ]imap.constants.php2024-06-13 02:01 25K 
[   ]errorfunc.configuration.php2024-06-13 02:01 25K 
[   ]class.solrclient.php2024-06-13 02:01 25K 
[   ]function.session-set-save-handler.php2024-06-13 02:01 25K 
[   ]class.domprocessinginstruction.php2024-06-13 02:01 24K 
[   ]language.oop5.visibility.php2024-06-13 02:01 24K 
[   ]language.generators.syntax.php2024-06-13 02:01 24K 
[   ]faq.build.php2024-06-13 02:01 24K 
[   ]function.preg-match.php2024-06-13 02:01 24K 
[   ]functions.anonymous.php2024-06-13 02:01 24K 
[   ]function.array-multisort.php2024-06-13 02:01 24K 
[   ]language.oop5.overloading.php2024-06-13 02:01 24K 
[   ]migration81.incompatible.php2024-06-13 02:01 24K 
[   ]class.gmagickdraw.php2024-06-13 02:01 24K 
[   ]class.intlrulebasedbreakiterator.php2024-06-13 02:01 24K 
[   ]migration72.new-functions.php2024-06-13 02:01 24K 
[   ]info.constants.php2024-06-13 02:01 24K 
[   ]function.dns-get-record.php2024-06-13 02:01 24K 
[   ]function.round.php2024-06-13 02:01 24K 
[   ]function.password-hash.php2024-06-13 02:01 24K 
[   ]class.mongodb-driver-bulkwrite.php2024-06-13 02:01 24K 
[   ]seaslog.configuration.php2024-06-13 02:01 24K 
[   ]function.db2-get-option.php2024-06-13 02:01 24K 
[   ]function.oci-define-by-name.php2024-06-13 02:01 23K 
[   ]eventbufferevent.connect.php2024-06-13 02:01 23K 
[   ]function.fopen.php2024-06-13 02:01 23K 
[   ]gearman.constants.php2024-06-13 02:01 23K 
[   ]function.fprintf.php2024-06-13 02:01 23K 
[   ]class.yaf-request-abstract.php2024-06-13 02:01 23K 
[   ]function.htmlspecialchars.php2024-06-13 02:01 23K 
[   ]features.http-auth.php2024-06-13 02:01 23K 
[   ]class.domnotation.php2024-06-13 02:01 23K 
[   ]class.datetimeimmutable.php2024-06-13 02:01 23K 
[   ]fann.constants.php2024-06-13 02:01 23K 
[   ]mysqli.autocommit.php2024-06-13 02:01 23K 
[   ]class.solrdocument.php2024-06-13 02:01 23K 
[   ]class.ds-sequence.php2024-06-13 02:01 23K 
[   ]oci8.taf.php2024-06-13 02:01 23K 
[   ]class.datetime.php2024-06-13 02:01 23K 
[   ]language.oop5.interfaces.php2024-06-13 02:01 23K 
[   ]class.mongodb-driver-clientencryption.php2024-06-13 02:01 23K 
[   ]function.proc-open.php2024-06-13 02:01 23K 
[   ]mongodb-driver-manager.executebulkwrite.php2024-06-13 02:01 23K 
[   ]class.eventbuffer.php2024-06-13 02:01 23K 
[   ]faq.using.php2024-06-13 02:01 23K 
[   ]class.domentityreference.php2024-06-13 02:01 23K 
[   ]function.assert.php2024-06-13 02:01 23K 
[   ]class.pdostatement.php2024-06-13 02:01 23K 
[   ]function.openssl-csr-new.php2024-06-13 02:01 23K 
[   ]class.yaf-request-http.php2024-06-13 02:01 23K 
[   ]function.substr.php2024-06-13 02:01 23K 
[   ]imagickkernel.frommatrix.php2024-06-13 02:01 23K 
[   ]book.event.php2024-06-13 02:01 23K 
[   ]book.fann.php2024-06-13 02:01 23K 
[   ]migration74.new-features.php2024-06-13 02:01 22K 
[   ]class.ds-map.php2024-06-13 02:01 22K 
[   ]function.db2-bind-param.php2024-06-13 02:01 22K 
[   ]class.eventhttprequest.php2024-06-13 02:01 22K 
[   ]mysqli.quickstart.statements.php2024-06-13 02:01 22K 
[   ]gearmanclient.donormal.php2024-06-13 02:01 22K 
[   ]function.imap-open.php2024-06-13 02:01 22K 
[   ]class.yaf-request-simple.php2024-06-13 02:01 22K 
[   ]book.gmagick.php2024-06-13 02:01 22K 
[   ]ref.pdo-mysql.php2024-06-13 02:01 22K 
[   ]class.dateperiod.php2024-06-13 02:01 22K 
[   ]function.db2-server-info.php2024-06-13 02:01 22K 
[   ]ref.fann.php2024-06-13 02:01 22K 
[   ]migration74.other-changes.php2024-06-13 02:01 22K 
[   ]features.gc.refcounting-basics.php2024-06-13 02:01 22K 
[   ]eventlistener.construct.php2024-06-13 02:01 22K 
[   ]function.stream-notification-callback.php2024-06-13 02:01 22K 
[   ]function.date.php2024-06-13 02:01 22K 
[   ]gearmanclient.do.php2024-06-13 02:01 22K 
[   ]function.exif-read-data.php2024-06-13 02:01 22K 
[   ]migration82.constants.php2024-06-13 02:01 22K 
[   ]class.reflectionproperty.php2024-06-13 02:01 22K 
[   ]class.ds-deque.php2024-06-13 02:01 22K 
[   ]mongodb.persistence.deserialization.php2024-06-13 02:01 21K 
[   ]class.seaslog.php2024-06-13 02:01 21K 
[   ]class.mongodb-driver-readpreference.php2024-06-13 02:01 21K 
[   ]oci8.installation.php2024-06-13 02:01 21K 
[   ]eio.constants.php2024-06-13 02:01 21K 
[   ]class.mongodb-driver-manager.php2024-06-13 02:01 21K 
[   ]security.database.sql-injection.php2024-06-13 02:01 21K 
[   ]mysqli-stmt.bind-param.php2024-06-13 02:01 21K 
[   ]class.pharfileinfo.php2024-06-13 02:01 21K 
[   ]class.stomp.php2024-06-13 02:01 21K 
[   ]class.ds-vector.php2024-06-13 02:01 21K 
[   ]class.intlcodepointbreakiterator.php2024-06-13 02:01 21K 
[   ]function.oci-execute.php2024-06-13 02:01 21K 
[   ]wincache.configuration.php2024-06-13 02:01 21K 
[   ]function.parse-ini-file.php2024-06-13 02:01 21K 
[   ]function.vfprintf.php2024-06-13 02:01 21K 
[   ]curlfile.construct.php2024-06-13 02:01 21K 
[   ]ibase.constants.php2024-06-13 02:01 21K 
[   ]example.xml-external-entity.php2024-06-13 02:01 21K 
[   ]class.ui-key.php2024-06-13 02:01 21K 
[   ]mysqli-result.fetch-fields.php2024-06-13 02:01 21K 
[   ]mysqlnd.config.php2024-06-13 02:01 21K 
[   ]trader.constants.php2024-06-13 02:01 21K 
[   ]class.reflectionfunction.php2024-06-13 02:01 21K 
[   ]class.splobjectstorage.php2024-06-13 02:01 21K 
[   ]refs.basic.other.php2024-06-13 02:01 21K 
[   ]langref.php2024-06-13 02:01 21K 
[   ]control-structures.foreach.php2024-06-13 02:01 21K 
[   ]book.dom.php2024-06-13 02:01 20K 
[   ]gearmanclient.addtaskbackground.php2024-06-13 02:01 20K 
[   ]migration72.incompatible.php2024-06-13 02:01 20K 
[   ]memcached.getmulti.php2024-06-13 02:01 20K 
[   ]extensions.alphabetical.php2024-06-13 02:01 20K 
[   ]function.vprintf.php2024-06-13 02:01 20K 
[   ]function.json-decode.php2024-06-13 02:01 20K 
[   ]function.vsprintf.php2024-06-13 02:01 20K 
[   ]domdocument.registernodeclass.php2024-06-13 02:01 20K 
[   ]ibm-db2.configuration.php2024-06-13 02:01 20K 
[   ]function.oci-set-prefetch.php2024-06-13 02:01 20K 
[   ]cc.license.php2024-06-13 02:01 20K 
[   ]sqlite3.setauthorizer.php2024-06-13 02:01 20K 
[   ]function.cubrid-bind.php2024-06-13 02:01 20K 
[   ]function.include.php2024-06-13 02:01 20K 
[TXT]faq.html.php2024-06-13 02:01 20K 
[   ]extensions.membership.php2024-06-13 02:01 20K 
[   ]language.types.integer.php2024-06-13 02:01 20K 
[   ]function.header.php2024-06-13 02:01 20K 
[   ]function.cubrid-schema.php2024-06-13 02:01 20K 
[   ]function.http-build-query.php2024-06-13 02:01 20K 
[   ]class.datetimeinterface.php2024-06-13 02:01 20K 
[TXT]phar.using.intro.php2024-06-13 02:01 20K 
[   ]function.socket-create-pair.php2024-06-13 02:01 20K 
[   ]dateperiod.construct.php2024-06-13 02:01 20K 
[   ]class.streamwrapper.php2024-06-13 02:01 20K 
[   ]class.yaf-dispatcher.php2024-06-13 02:01 20K 
[   ]control-structures.match.php2024-06-13 02:01 20K 
[   ]migration81.deprecated.php2024-06-13 02:01 20K 
[   ]random-randomizer.getfloat.php2024-06-13 02:01 20K 
[   ]function.date-parse.php2024-06-13 02:01 20K 
[   ]mongodb.persistence.serialization.php2024-06-13 02:01 20K 
[   ]function.imagettfbbox.php2024-06-13 02:01 20K 
[   ]class.oauth.php2024-06-13 02:01 20K 
[   ]class.directoryiterator.php2024-06-13 02:01 20K 
[   ]dom.constants.php2024-06-13 02:01 20K 
[   ]mysqlnd.plugin.architecture.php2024-06-13 02:01 20K 
[   ]migration72.new-features.php2024-06-13 02:01 19K 
[   ]class.splfixedarray.php2024-06-13 02:01 19K 
[   ]class.reflectionfunctionabstract.php2024-06-13 02:01 19K 
[   ]function.mktime.php2024-06-13 02:01 19K 
[   ]language.exceptions.extending.php2024-06-13 02:01 19K 
[   ]function.ldap-set-option.php2024-06-13 02:01 19K 
[   ]function.array-udiff-uassoc.php2024-06-13 02:01 19K 
[   ]migration74.incompatible.php2024-06-13 02:01 19K 
[   ]language.operators.precedence.php2024-06-13 02:01 19K 
[   ]book.mysqli.php2024-06-13 02:01 19K 
[   ]class.solrinputdocument.php2024-06-13 02:01 19K 
[   ]phar.webphar.php2024-06-13 02:01 19K 
[   ]mongodb.monitoring.php2024-06-13 02:01 19K 
[   ]mysqli.query.php2024-06-13 02:01 19K 
[   ]migration73.incompatible.php2024-06-13 02:01 19K 
[   ]function.xml-parse-into-struct.php2024-06-13 02:01 19K 
[   ]migration80.deprecated.php2024-06-13 02:01 19K 
[   ]uodbc.constants.php2024-06-13 02:01 19K 
[   ]function.nl-langinfo.php2024-06-13 02:01 19K 
[   ]pdostatement.execute.php2024-06-13 02:01 19K 
[   ]function.imagecopyresampled.php2024-06-13 02:01 19K 
[   ]class.mysqli-stmt.php2024-06-13 02:01 19K 
[   ]errorfunc.examples.php2024-06-13 02:01 19K 
[   ]function.oci-close.php2024-06-13 02:01 19K 
[   ]class.yaf-controller-abstract.php2024-06-13 02:01 19K 
[   ]class.memcache.php2024-06-13 02:01 19K 
[   ]class.eventsslcontext.php2024-06-13 02:01 19K 
[   ]function.utf8-decode.php2024-06-13 02:01 19K 
[   ]function.ldap-modify-batch.php2024-06-13 02:01 19K 
[   ]intlcalendar.clear.php2024-06-13 02:01 19K 
[   ]function.imagefilledarc.php2024-06-13 02:01 19K 
[   ]control-structures.switch.php2024-06-13 02:01 19K 
[   ]function.money-format.php2024-06-13 02:01 19K 
[   ]function.imagettftext.php2024-06-13 02:01 19K 
[   ]function.file-get-contents.php2024-06-13 02:01 19K 
[   ]function.openssl-encrypt.php2024-06-13 02:01 19K 
[   ]function.oci-fetch-object.php2024-06-13 02:01 18K 
[   ]class.tidy.php2024-06-13 02:01 18K 
[   ]class.simplexmlelement.php2024-06-13 02:01 18K 
[   ]mongodb-driver-bulkwrite.construct.php2024-06-13 02:01 18K 
[   ]datetimeimmutable.construct.php2024-06-13 02:01 18K 
[TXT]mongodb.tutorial.apm.php2024-06-13 02:01 18K 
[   ]class.yaf-loader.php2024-06-13 02:01 18K 
[   ]language.references.whatdo.php2024-06-13 02:01 18K 
[   ]mysqli.change-user.php2024-06-13 02:01 18K 
[   ]class.swoole-coroutine.php2024-06-13 02:01 18K 
[   ]class.ds-set.php2024-06-13 02:01 18K 
[   ]language.operators.type.php2024-06-13 02:01 18K 
[   ]mongodb-driver-readpreference.construct.php2024-06-13 02:01 18K 
[   ]function.htmlentities.php2024-06-13 02:01 18K 
[   ]function.stream-filter-register.php2024-06-13 02:01 18K 
[   ]class.svm.php2024-06-13 02:01 18K 
[   ]class.event.php2024-06-13 02:01 18K 
[   ]yaf-dispatcher.setview.php2024-06-13 02:01 18K 
[   ]wrappers.php.php2024-06-13 02:01 18K 
[   ]mysqli-result.data-seek.php2024-06-13 02:01 18K 
[   ]class.ffi.php2024-06-13 02:01 18K 
[   ]reserved.variables.server.php2024-06-13 02:01 18K 
[   ]function.array-udiff-assoc.php2024-06-13 02:01 18K 
[   ]class.parle-rparser.php2024-06-13 02:01 18K 
[   ]function.unserialize.php2024-06-13 02:01 18K 
[   ]function.eio-readdir.php2024-06-13 02:01 18K 
[   ]function.imagecolorallocatealpha.php2024-06-13 02:01 18K 
[   ]function.oci-new-descriptor.php2024-06-13 02:01 18K 
[   ]oci8.configuration.php2024-06-13 02:01 18K 
[   ]migration73.new-features.php2024-06-13 02:01 18K 
[   ]mysqli-result.fetch-array.php2024-06-13 02:01 18K 
[   ]class.parle-parser.php2024-06-13 02:01 18K 
[   ]eventhttp.setcallback.php2024-06-13 02:01 18K 
[   ]language.variables.external.php2024-06-13 02:01 18K 
[   ]ref.trader.php2024-06-13 02:01 18K 
[   ]class.splfileinfo.php2024-06-13 02:01 18K 
[   ]book.datetime.php2024-06-13 02:01 18K 
[   ]function.array-splice.php2024-06-13 02:01 18K 
[   ]outcontrol.user-level-output-buffers.php2024-06-13 02:01 17K 
[   ]eventbufferevent.connecthost.php2024-06-13 02:01 17K 
[   ]function.preg-replace-callback.php2024-06-13 02:01 17K 
[   ]class.yaf-config-ini.php2024-06-13 02:01 17K 
[   ]sockets.examples.php2024-06-13 02:01 17K 
[   ]function.stream-socket-client.php2024-06-13 02:01 17K 
[   ]book.sodium.php2024-06-13 02:01 17K 
[   ]function.mysql-connect.php2024-06-13 02:01 17K 
[   ]class.mongodb-driver-readconcern.php2024-06-13 02:01 17K 
[   ]function.call-user-func-array.php2024-06-13 02:01 17K 
[   ]function.fsockopen.php2024-06-13 02:01 17K 
[   ]function.echo.php2024-06-13 02:01 17K 
[   ]ref.sodium.php2024-06-13 02:01 17K 
[   ]class.regexiterator.php2024-06-13 02:01 17K 
[   ]class.spoofchecker.php2024-06-13 02:01 17K 
[   ]migration73.other-changes.php2024-06-13 02:01 17K 
[   ]radius.constants.vendor-specific.php2024-06-13 02:01 17K 
[   ]function.array-column.php2024-06-13 02:01 17K 
[   ]book.trader.php2024-06-13 02:01 17K 
[   ]function.getimagesize.php2024-06-13 02:01 17K 
[   ]mysqli-result.fetch-field-direct.php2024-06-13 02:01 17K 
[   ]function.str-replace.php2024-06-13 02:01 17K 
[   ]class.spldoublylinkedlist.php2024-06-13 02:01 17K 
[   ]eventhttp.construct.php2024-06-13 02:01 17K 
[   ]json.constants.php2024-06-13 02:01 17K 
[   ]datetime.diff.php2024-06-13 02:01 17K 
[   ]rar.examples.php2024-06-13 02:01 17K 
[   ]mysqli-result.fetch-assoc.php2024-06-13 02:01 17K 
[   ]stream.streamwrapper.example-1.php2024-06-13 02:01 17K 
[   ]gearman.examples-reverse-task.php2024-06-13 02:01 17K 
[   ]function.parse-url.php2024-06-13 02:01 17K 
[   ]rararchive.open.php2024-06-13 02:01 17K 
[   ]function.range.php2024-06-13 02:01 17K 
[   ]filter.filters.flags.php2024-06-13 02:01 17K 
[   ]mysqli.begin-transaction.php2024-06-13 02:01 17K 
[   ]pdo.prepare.php2024-06-13 02:01 17K 
[   ]class.cachingiterator.php2024-06-13 02:01 17K 
[   ]imagick.getimagehistogram.php2024-06-13 02:01 17K 
[   ]class.splqueue.php2024-06-13 02:01 17K 
[   ]function.list.php2024-06-13 02:01 17K 
[   ]pdo.prepared-statements.php2024-06-13 02:01 17K 
[   ]pdo.sqlitecreateaggregate.php2024-06-13 02:01 17K 
[   ]swoole.constants.php2024-06-13 02:01 17K 
[   ]function.array-filter.php2024-06-13 02:01 17K 
[   ]function.oci-new-connect.php2024-06-13 02:01 17K 
[   ]mysqli-result.fetch-field.php2024-06-13 02:01 17K 
[   ]mysqli.multi-query.php2024-06-13 02:01 17K 
[   ]class.mongodb-bson-binary.php2024-06-13 02:01 17K 
[   ]function.simdjson-decode.php2024-06-13 02:01 17K 
[   ]function.imagegif.php2024-06-13 02:01 17K 
[   ]solrquery.collapse.php2024-06-13 02:01 17K 
[   ]book.oci8.php2024-06-13 02:01 17K 
[   ]function.var-export.php2024-06-13 02:01 17K 
[   ]function.substr-replace.php2024-06-13 02:01 17K 
[   ]class.arrayiterator.php2024-06-13 02:01 17K 
[   ]imagickdraw.affine.php2024-06-13 02:01 17K 
[   ]function.imap-mail-compose.php2024-06-13 02:01 17K 
[   ]class.mongodb-driver-serverdescription.php2024-06-13 02:01 17K 
[   ]set.mongodb.php2024-06-13 02:01 17K 
[   ]class.arrayobject.php2024-06-13 02:01 17K 
[   ]function.ldap-get-option.php2024-06-13 02:01 17K 
[   ]imagickdraw.bezier.php2024-06-13 02:01 16K 
[   ]function.socket-recv.php2024-06-13 02:01 16K 
[   ]function.socket-select.php2024-06-13 02:01 16K 
[   ]function.session-regenerate-id.php2024-06-13 02:01 16K 
[   ]mongodb-bson-serializable.bsonserialize.php2024-06-13 02:01 16K 
[   ]function.stat.php2024-06-13 02:01 16K 
[   ]class.simplexmliterator.php2024-06-13 02:01 16K 
[   ]mongodb-driver-manager.executequery.php2024-06-13 02:01 16K 
[   ]function.openssl-dh-compute-key.php2024-06-13 02:01 16K 
[   ]function.ldap-search.php2024-06-13 02:01 16K 
[   ]regexp.reference.unicode.php2024-06-13 02:01 16K 
[   ]function.count.php2024-06-13 02:01 16K 
[   ]imagickpixel.issimilar.php2024-06-13 02:01 16K 
[   ]function.fileperms.php2024-06-13 02:01 16K 
[   ]function.mb-detect-encoding.php2024-06-13 02:01 16K 
[   ]class.swoole-client.php2024-06-13 02:01 16K 
[   ]class.reflectionparameter.php2024-06-13 02:01 16K 
[   ]function.isset.php2024-06-13 02:01 16K 
[   ]reflectionfunctionabstract.getattributes.php2024-06-13 02:01 16K 
[   ]mysqli-stmt.prepare.php2024-06-13 02:01 16K 
[   ]migration74.deprecated.php2024-06-13 02:01 16K 
[   ]function.db2-lob-read.php2024-06-13 02:01 16K 
[   ]zip.examples.php2024-06-13 02:01 16K 
[   ]function.stream-select.php2024-06-13 02:01 16K 
[   ]function.db2-fetch-row.php2024-06-13 02:01 16K 
[   ]function.cubrid-next-result.php2024-06-13 02:01 16K 
[   ]session.security.ini.php2024-06-13 02:01 16K 
[   ]regexp.reference.escape.php2024-06-13 02:01 16K 
[   ]pdo.cubrid-schema.php2024-06-13 02:01 16K 
[   ]mbstring.configuration.php2024-06-13 02:01 16K 
[   ]function.ldap-list.php2024-06-13 02:01 16K 
[   ]class.reflectionclassconstant.php2024-06-13 02:01 16K 
[   ]class.mysqli-result.php2024-06-13 02:01 16K 
[   ]ldap.examples-controls.php2024-06-13 02:01 16K 
[   ]migration83.incompatible.php2024-06-13 02:01 16K 
[   ]context.http.php2024-06-13 02:01 16K 
[   ]features.file-upload.post-method.php2024-06-13 02:01 16K 
[   ]sqlite3.createaggregate.php2024-06-13 02:01 16K 
[   ]language.oop5.variance.php2024-06-13 02:01 16K 
[   ]language.expressions.php2024-06-13 02:01 16K 
[   ]intlcalendar.set.php2024-06-13 02:01 16K 
[   ]class.vtiful-kernel-format.php2024-06-13 02:01 16K 
[   ]function.mysql-fetch-array.php2024-06-13 02:01 16K 
[   ]class.yaf-plugin-abstract.php2024-06-13 02:01 16K 
[   ]function.ob-start.php2024-06-13 02:01 16K 
[   ]class.quickhashintstringhash.php2024-06-13 02:01 16K 
[   ]class.sessionhandlerinterface.php2024-06-13 02:01 16K 
[   ]mongodb-driver-bulkwrite.update.php2024-06-13 02:01 16K 
[   ]function.date-sun-info.php2024-06-13 02:01 16K 
[   ]book.image.php2024-06-13 02:01 16K 
[   ]function.imagefttext.php2024-06-13 02:01 16K 
[   ]class.recursivearrayiterator.php2024-06-13 02:01 16K 
[   ]filters.compression.php2024-06-13 02:01 16K 
[   ]ffi.examples-basic.php2024-06-13 02:01 16K 
[   ]mysqli-result.fetch-object.php2024-06-13 02:01 15K 
[   ]function.mysql-real-escape-string.php2024-06-13 02:01 15K 
[   ]function.ssh2-connect.php2024-06-13 02:01 15K 
[   ]dateinterval.createfromdatestring.php2024-06-13 02:01 15K 
[   ]function.explode.php2024-06-13 02:01 15K 
[   ]function.utf8-encode.php2024-06-13 02:01 15K 
[   ]mysqli.execute-query.php2024-06-13 02:01 15K 
[   ]mysqli-stmt.get-result.php2024-06-13 02:01 15K 
[   ]apcu.configuration.php2024-06-13 02:01 15K 
[   ]book.phar.php2024-06-13 02:01 15K 
[   ]migration80.other-changes.php2024-06-13 02:01 15K 
[   ]function.imageline.php2024-06-13 02:01 15K 
[   ]pdostatement.bindparam.php2024-06-13 02:01 15K 
[   ]function.setlocale.php2024-06-13 02:01 15K 
[   ]class.datetimezone.php2024-06-13 02:01 15K 
[   ]function.sqlsrv-fetch-array.php2024-06-13 02:01 15K 
[   ]yaf-route-regex.construct.php2024-06-13 02:01 15K 
[   ]intldateformatter.setlenient.php2024-06-13 02:01 15K 
[   ]class.mongodb-driver-session.php2024-06-13 02:01 15K 
[   ]mysqli-result.field-seek.php2024-06-13 02:01 15K 
[   ]ref.pgsql.php2024-06-13 02:01 15K 
[   ]migration83.constants.php2024-06-13 02:01 15K 
[   ]datetime.examples-arithmetic.php2024-06-13 02:01 15K 
[   ]ref.image.php2024-06-13 02:01 15K 
[   ]function.oci-pconnect.php2024-06-13 02:01 15K 
[   ]svn.constants.php2024-06-13 02:01 15K 
[   ]function.unset.php2024-06-13 02:01 15K 
[   ]function.stream-socket-server.php2024-06-13 02:01 15K 
[   ]class.parle-rlexer.php2024-06-13 02:01 15K 
[   ]function.dba-open.php2024-06-13 02:01 15K 
[   ]seaslog.examples.php2024-06-13 02:01 15K 
[   ]mbstring.encodings.php2024-06-13 02:01 15K 
[   ]function.imagejpeg.php2024-06-13 02:01 15K 
[   ]function.cubrid-commit.php2024-06-13 02:01 15K 
[   ]mysqli-stmt.result-metadata.php2024-06-13 02:01 15K 
[   ]class.ocilob.php2024-06-13 02:01 15K 
[   ]function.imagewbmp.php2024-06-13 02:01 15K 
[   ]mysqli-result.current-field.php2024-06-13 02:01 15K 
[   ]function.getopt.php2024-06-13 02:01 15K 
[   ]mysqli.affected-rows.php2024-06-13 02:01 15K 
[   ]function.html-entity-decode.php2024-06-13 02:01 15K 
[   ]function.bindec.php2024-06-13 02:01 15K 
[   ]refs.remote.other.php2024-06-13 02:01 15K 
[   ]gearmanclient.addtask.php2024-06-13 02:01 15K 
[   ]language.namespaces.importing.php2024-06-13 02:01 15K 
[   ]function.cubrid-connect-with-url.php2024-06-13 02:01 15K 
[   ]class.quickhashinthash.php2024-06-13 02:01 15K 
[   ]mysqli.use-result.php2024-06-13 02:01 15K 
[   ]mysqli-driver.report-mode.php2024-06-13 02:01 15K 
[   ]language.oop5.late-static-bindings.php2024-06-13 02:01 15K 
[   ]function.mongodb.bson-tojson.php2024-06-13 02:01 15K 
[   ]ref.strings.php2024-06-13 02:01 15K 
[   ]dateinterval.format.php2024-06-13 02:01 15K 
[   ]class.evperiodic.php2024-06-13 02:01 15K 
[   ]function.session-start.php2024-06-13 02:01 15K 
[   ]streamwrapper.dir-readdir.php2024-06-13 02:01 15K 
[   ]function.fread.php2024-06-13 02:01 15K 
[   ]function.fwrite.php2024-06-13 02:01 15K 
[   ]class.eventbase.php2024-06-13 02:01 15K 
[   ]function.svn-status.php2024-06-13 02:01 15K 
[   ]datetimezone.listidentifiers.php2024-06-13 02:01 15K 
[   ]oci8.dtrace.php2024-06-13 02:01 15K 
[   ]function.pathinfo.php2024-06-13 02:01 14K 
[   ]index.php2024-06-13 02:01 14K 
[   ]book.gearman.php2024-06-13 02:01 14K 
[   ]features.gc.performance-considerations.php2024-06-13 02:01 14K 
[   ]function.date-sunset.php2024-06-13 02:01 14K 
[   ]class.swoole-http-client.php2024-06-13 02:01 14K 
[   ]function.extract.php2024-06-13 02:01 14K 
[   ]yaf.appconfig.php2024-06-13 02:01 14K 
[   ]class.recursiveregexiterator.php2024-06-13 02:01 14K 
[   ]function.date-sunrise.php2024-06-13 02:01 14K 
[   ]features.dtrace.dtrace.php2024-06-13 02:01 14K 
[   ]function.cubrid-query.php2024-06-13 02:01 14K 
[   ]function.stream-get-meta-data.php2024-06-13 02:01 14K 
[   ]solrinputdocument.addchilddocument.php2024-06-13 02:01 14K 
[   ]intldateformatter.islenient.php2024-06-13 02:01 14K 
[   ]function.assert-options.php2024-06-13 02:01 14K 
[   ]intldateformatter.formatobject.php2024-06-13 02:01 14K 
[   ]mysqli.prepare.php2024-06-13 02:01 14K 
[   ]function.cubrid-rollback.php2024-06-13 02:01 14K 
[   ]filter.filters.validate.php2024-06-13 02:01 14K 
[   ]function.call-user-func.php2024-06-13 02:01 14K 
[   ]class.recursiveiteratoriterator.php2024-06-13 02:01 14K 
[   ]imagickdraw.pushpattern.php2024-06-13 02:01 14K 
[   ]features.commandline.usage.php2024-06-13 02:01 14K 
[   ]mongodb-driver-clientencryption.encryptexpression.php2024-06-13 02:01 14K 
[   ]solrinputdocument.addchilddocuments.php2024-06-13 02:01 14K 
[   ]pdo.lobs.php2024-06-13 02:01 14K 
[   ]phar.buildfromiterator.php2024-06-13 02:01 14K 
[   ]mysqli.overview.php2024-06-13 02:01 14K 
[   ]function.imagecopyresized.php2024-06-13 02:01 14K 
[   ]class.solrresponse.php2024-06-13 02:01 14K 
[   ]function.get-html-translation-table.php2024-06-13 02:01 14K 
[   ]mysqli-stmt.fetch.php2024-06-13 02:01 14K 
[   ]class.errorexception.php2024-06-13 02:01 14K 
[   ]function.ldap-control-paged-result.php2024-06-13 02:01 14K 
[   ]function.strpos.php2024-06-13 02:01 14K 
[   ]function.sqlsrv-prepare.php2024-06-13 02:01 14K 
[   ]datetime.modify.php2024-06-13 02:01 14K 
[   ]intldateformatter.setcalendar.php2024-06-13 02:01 14K 
[   ]function.filter-var.php2024-06-13 02:01 14K 
[   ]messageformatter.formatmessage.php2024-06-13 02:01 14K 
[   ]function.ftp-nb-get.php2024-06-13 02:01 14K 
[   ]function.cubrid-pconnect-with-url.php2024-06-13 02:01 14K 
[   ]book.strings.php2024-06-13 02:01 14K 
[   ]function.openssl-csr-sign.php2024-06-13 02:01 14K 
[   ]language.operators.increment.php2024-06-13 02:01 14K 
[   ]security.filesystem.php2024-06-13 02:01 14K 
[   ]function.cubrid-execute.php2024-06-13 02:01 14K 
[   ]class.evstat.php2024-06-13 02:01 14K 
[   ]class.splstack.php2024-06-13 02:01 14K 
[   ]intro.eio.php2024-06-13 02:01 14K 
[   ]function.oci-rollback.php2024-06-13 02:01 14K 
[   ]function.mysql-query.php2024-06-13 02:01 14K 
[   ]function.socket-recvfrom.php2024-06-13 02:01 14K 
[   ]mysql-xdevapi.constants.php2024-06-13 02:01 14K 
[   ]class.soapfault.php2024-06-13 02:01 14K 
[   ]function.cubrid-get-db-parameter.php2024-06-13 02:01 14K 
[   ]function.json-last-error.php2024-06-13 02:01 14K 
[   ]class.evtimer.php2024-06-13 02:01 14K 
[   ]mongodb-driver-command.construct.php2024-06-13 02:01 14K 
[   ]function.array-walk.php2024-06-13 02:01 14K 
[   ]function.pack.php2024-06-13 02:01 14K 
[   ]function.easter-date.php2024-06-13 02:01 14K 
[   ]class.mongodb-driver-command.php2024-06-13 02:01 14K 
[   ]class.eventdnsbase.php2024-06-13 02:01 14K 
[   ]function.date-parse-from-format.php2024-06-13 02:01 14K 
[   ]function.yaz-record.php2024-06-13 02:01 14K 
[   ]function.imageftbbox.php2024-06-13 02:01 14K 
[   ]function.ps-translate.php2024-06-13 02:01 14K 
[   ]class.dateinterval.php2024-06-13 02:01 14K 
[   ]function.strtok.php2024-06-13 02:01 14K 
[   ]function.openssl-get-cipher-methods.php2024-06-13 02:01 14K 
[   ]function.intval.php2024-06-13 02:01 14K 
[   ]funcref.php2024-06-13 02:01 14K 
[   ]function.mcrypt-module-open.php2024-06-13 02:01 14K 
[   ]class.luasandbox.php2024-06-13 02:01 14K 
[   ]language.variables.basics.php2024-06-13 02:01 14K 
[   ]class.mongodb-driver-serverapi.php2024-06-13 02:01 14K 
[   ]function.array-slice.php2024-06-13 02:01 14K 
[   ]snmp.set.php2024-06-13 02:01 14K 
[   ]class.recursivecachingiterator.php2024-06-13 02:01 14K 
[   ]uconverter.transcode.php2024-06-13 02:01 14K 
[   ]function.imap-createmailbox.php2024-06-13 02:01 14K 
[   ]function.cubrid-fetch-field.php2024-06-13 02:01 14K 
[   ]info.configuration.php2024-06-13 02:01 14K 
[   ]class.mongodb-bson-document.php2024-06-13 02:01 14K 
[   ]simdjson.constants.php2024-06-13 02:01 14K 
[   ]reflectionparameter.getattributes.php2024-06-13 02:01 14K 
[   ]function.imap-search.php2024-06-13 02:01 14K 
[   ]function.mcrypt-encrypt.php2024-06-13 02:01 14K 
[   ]function.trim.php2024-06-13 02:01 14K 
[   ]function.oci-bind-array-by-name.php2024-06-13 02:01 14K 
[   ]language.oop5.changelog.php2024-06-13 02:01 14K 
[   ]domdocument.createelementns.php2024-06-13 02:01 14K 
[   ]function.cubrid-lob2-write.php2024-06-13 02:01 14K 
[   ]wrappers.rar.php2024-06-13 02:01 14K 
[   ]oauth.constants.php2024-06-13 02:01 14K 
[   ]function.strrpos.php2024-06-13 02:01 14K 
[   ]ref.imap.php2024-06-13 02:01 14K 
[   ]pdo.query.php2024-06-13 02:01 14K 
[   ]function.mongodb.bson-tocanonicalextendedjson.php2024-06-13 02:01 14K 
[   ]ds-map.put.php2024-06-13 02:01 14K 
[   ]function.snmp3-set.php2024-06-13 02:01 14K 
[   ]function.ob-list-handlers.php2024-06-13 02:01 14K 
[   ]filter.filters.sanitize.php2024-06-13 02:01 14K 
[   ]reflectionclassconstant.getattributes.php2024-06-13 02:01 14K 
[   ]function.mysql-xdevapi-getsession.php2024-06-13 02:01 14K 
[   ]function.oci-fetch.php2024-06-13 02:01 14K 
[   ]class.imagickpixel.php2024-06-13 02:01 14K 
[   ]book.cubrid.php2024-06-13 02:01 14K 
[   ]cubrid.examples.php2024-06-13 02:01 14K 
[   ]function.crypt.php2024-06-13 02:01 14K 
[   ]cubrid.constants.php2024-06-13 02:01 14K 
[   ]function.imagearc.php2024-06-13 02:01 14K 
[   ]reflectionproperty.getattributes.php2024-06-13 02:01 14K 
[   ]solrclient.adddocument.php2024-06-13 02:01 14K 
[   ]memcache.addserver.php2024-06-13 02:01 14K 
[   ]language.enumerations.methods.php2024-06-13 02:01 13K 
[   ]dateinterval.construct.php2024-06-13 02:01 13K 
[   ]reflectionmethod.construct.php2024-06-13 02:01 13K 
[   ]function.socket-create.php2024-06-13 02:01 13K 
[   ]domxpath.registerphpfunctions.php2024-06-13 02:01 13K 
[   ]book.pgsql.php2024-06-13 02:01 13K 
[   ]function.openssl-verify.php2024-06-13 02:01 13K 
[   ]imagick.functionimage.php2024-06-13 02:01 13K 
[   ]pdo.setattribute.php2024-06-13 02:01 13K 
[   ]function.wincache-ucache-set.php2024-06-13 02:01 13K 
[   ]function.cubrid-lob2-read.php2024-06-13 02:01 13K 
[   ]reflectionproperty.construct.php2024-06-13 02:01 13K 
[   ]filesystem.constants.php2024-06-13 02:01 13K 
[   ]class.quickhashstringinthash.php2024-06-13 02:01 13K 
[   ]imagickkernel.addunitykernel.php2024-06-13 02:01 13K 
[   ]mongodb-driver-server.executecommand.php2024-06-13 02:01 13K 
[   ]function.mongodb.bson-torelaxedextendedjson.php2024-06-13 02:01 13K 
[   ]class.swoole-process.php2024-06-13 02:01 13K 
[   ]function.wincache-ucache-add.php2024-06-13 02:01 13K 
[   ]features.commandline.webserver.php2024-06-13 02:01 13K 
[   ]function.oci-password-change.php2024-06-13 02:01 13K 
[   ]class.normalizer.php2024-06-13 02:01 13K 
[   ]libxml.constants.php2024-06-13 02:01 13K 
[   ]language.oop5.inheritance.php2024-06-13 02:01 13K 
[   ]function.ldap-read.php2024-06-13 02:01 13K 
[   ]function.curl-multi-setopt.php2024-06-13 02:01 13K 
[   ]intlcalendar.createinstance.php2024-06-13 02:01 13K 
[   ]function.strtotime.php2024-06-13 02:01 13K 
[   ]function.svn-diff.php2024-06-13 02:01 13K 
[   ]function.filter-input-array.php2024-06-13 02:01 13K 
[   ]function.spl-autoload-register.php2024-06-13 02:01 13K 
[   ]classobj.examples.php2024-06-13 02:01 13K 
[   ]rnp.constants.php2024-06-13 02:01 13K 
[   ]mysqli-stmt.bind-result.php2024-06-13 02:01 13K 
[   ]function.preg-split.php2024-06-13 02:01 13K 
[   ]network.constants.php2024-06-13 02:01 13K 
[   ]function.file-put-contents.php2024-06-13 02:01 13K 
[   ]install.unix.apache2.php2024-06-13 02:01 13K 
[   ]soapclient.soapcall.php2024-06-13 02:01 13K 
[   ]ref.array.php2024-06-13 02:01 13K 
[   ]class.gearmanworker.php2024-06-13 02:01 13K 
[   ]function.ps-begin-pattern.php2024-06-13 02:01 13K 
[   ]function.pg-fetch-array.php2024-06-13 02:01 13K 
[   ]function.var-representation.php2024-06-13 02:01 13K 
[   ]imagickdraw.setstrokedasharray.php2024-06-13 02:01 13K 
[   ]function.flock.php2024-06-13 02:01 13K 
[   ]sqlite3stmt.bindparam.php2024-06-13 02:01 13K 
[   ]function.stream-socket-enable-crypto.php2024-06-13 02:01 13K 
[   ]locale.composelocale.php2024-06-13 02:01 13K 
[   ]yaf-route-rewrite.construct.php2024-06-13 02:01 13K 
[   ]stomp.ack.php2024-06-13 02:01 13K 
[   ]book.ev.php2024-06-13 02:01 13K 
[   ]mysqli-stmt.sqlstate.php2024-06-13 02:01 13K 
[   ]function.mysql-fetch-field.php2024-06-13 02:01 13K 
[   ]language.namespaces.rules.php2024-06-13 02:01 13K 
[   ]function.openssl-sign.php2024-06-13 02:01 13K 
[   ]collator.setstrength.php2024-06-13 02:01 13K 
[   ]function.fgetcsv.php2024-06-13 02:01 13K 
[   ]function.array-diff-key.php2024-06-13 02:01 13K 
[   ]function.min.php2024-06-13 02:01 13K 
[   ]mysqli.poll.php2024-06-13 02:01 13K 
[   ]class.yaf-config-simple.php2024-06-13 02:01 13K 
[   ]class.parle-lexer.php2024-06-13 02:01 13K 
[   ]class.recursivecallbackfilteriterator.php2024-06-13 02:01 13K 
[   ]imagickkernel.scale.php2024-06-13 02:01 13K 
[   ]calendar.constants.php2024-06-13 02:01 13K 
[   ]class.ui-controls-grid.php2024-06-13 02:01 13K 
[   ]context.ssl.php2024-06-13 02:01 13K 
[   ]openal.constants.php2024-06-13 02:01 13K 
[   ]mongodb-driver-writeresult.getwriteerrors.php2024-06-13 02:01 13K 
[   ]class.ui-window.php2024-06-13 02:01 13K 
[   ]rarentry.getattr.php2024-06-13 02:01 13K 
[   ]configure.about.php2024-06-13 02:01 13K 
[   ]mysqli.real-escape-string.php2024-06-13 02:01 13K 
[   ]mysqli.warning-count.php2024-06-13 02:01 13K 
[   ]mongodb-driver-manager.createclientencryption.php2024-06-13 02:01 13K 
[   ]function.get-class.php2024-06-13 02:01 13K 
[   ]imagickdraw.setfillrule.php2024-06-13 02:01 13K 
[   ]function.imagedashedline.php2024-06-13 02:01 13K 
[   ]ref.pdo-odbc.php2024-06-13 02:01 13K 
[   ]mysqli.select-db.php2024-06-13 02:01 13K 
[   ]snmp.walk.php2024-06-13 02:01 13K 
[   ]class.reflectionenumbackedcase.php2024-06-13 02:01 13K 
[   ]class.oauthprovider.php2024-06-13 02:01 13K 
[   ]mongodb-driver-clientencryption.encrypt.php2024-06-13 02:01 13K 
[   ]book.array.php2024-06-13 02:01 13K 
[   ]class.quickhashintset.php2024-06-13 02:01 13K 
[   ]function.print.php2024-06-13 02:01 13K 
[   ]ref.ibase.php2024-06-13 02:01 13K 
[   ]datetimeimmutable.setisodate.php2024-06-13 02:01 13K 
[   ]wrappers.ssh2.php2024-06-13 02:01 13K 
[   ]appendices.php2024-06-13 02:01 13K 
[   ]mysqli-stmt.error-list.php2024-06-13 02:01 13K 
[   ]reflectionclass.getattributes.php2024-06-13 02:01 13K 
[   ]function.pg-select.php2024-06-13 02:01 13K 
[   ]ziparchive.open.php2024-06-13 02:01 13K 
[   ]function.ps-show-boxed.php2024-06-13 02:01 13K 
[   ]features.commandline.differences.php2024-06-13 02:01 13K 
[   ]book.ibase.php2024-06-13 02:01 13K 
[   ]function.mb-encode-numericentity.php2024-06-13 02:01 13K 
[   ]function.array-merge.php2024-06-13 02:01 13K 
[   ]class.eventlistener.php2024-06-13 02:01 13K 
[   ]simplexmlelement.children.php2024-06-13 02:01 13K 
[   ]gearman.examples-reverse.php2024-06-13 02:01 13K 
[   ]function.sort.php2024-06-13 02:01 13K 
[   ]function.hash-pbkdf2.php2024-06-13 02:01 12K 
[   ]mongodb-bson-document.tocanonicalextendedjson.php2024-06-13 02:01 12K 
[   ]function.pg-query.php2024-06-13 02:01 12K 
[   ]function.odbc-tables.php2024-06-13 02:01 12K 
[   ]class.yaf-action-abstract.php2024-06-13 02:01 12K 
[   ]function.array-diff-ukey.php2024-06-13 02:01 12K 
[   ]function.is-subclass-of.php2024-06-13 02:01 12K 
[   ]function.levenshtein.php2024-06-13 02:01 12K 
[   ]class.solrgenericresponse.php2024-06-13 02:01 12K 
[   ]intlcalendar.getskippedwalltimeoption.php2024-06-13 02:01 12K 
[   ]function.mqseries-connx.php2024-06-13 02:01 12K 
[   ]class.swoole-table.php2024-06-13 02:01 12K 
[   ]mysqli-result.fetch-column.php2024-06-13 02:01 12K 
[   ]function.max.php2024-06-13 02:01 12K 
[   ]class.solrupdateresponse.php2024-06-13 02:01 12K 
[   ]function.cubrid-lob2-seek64.php2024-06-13 02:01 12K 
[   ]mongodb-driver-manager.startsession.php2024-06-13 02:01 12K 
[   ]evtimer.construct.php2024-06-13 02:01 12K 
[   ]function.imagecolorclosestalpha.php2024-06-13 02:01 12K 
[   ]parle.pattern.matching.php2024-06-13 02:01 12K 
[   ]mysqli.quickstart.connections.php2024-06-13 02:01 12K 
[   ]class.yaf-application.php2024-06-13 02:01 12K 
[   ]jsonserializable.jsonserialize.php2024-06-13 02:01 12K 
[   ]class.yaf-session.php2024-06-13 02:01 12K 
[   ]function.mysql-affected-rows.php2024-06-13 02:01 12K 
[   ]function.openssl-pkcs7-sign.php2024-06-13 02:01 12K 
[   ]class.solrqueryresponse.php2024-06-13 02:01 12K 
[   ]function.oci-parse.php2024-06-13 02:01 12K 
[   ]class.evio.php2024-06-13 02:01 12K 
[   ]function.imap-get-quota.php2024-06-13 02:01 12K 
[   ]function.mqseries-put.php2024-06-13 02:01 12K 
[   ]function.imap-getmailboxes.php2024-06-13 02:01 12K 
[   ]class.com.php2024-06-13 02:01 12K 
[   ]function.eio-link.php2024-06-13 02:01 12K 
[   ]class.reflectionenumunitcase.php2024-06-13 02:01 12K 
[   ]intldateformatter.settimezone.php2024-06-13 02:01 12K 
[   ]function.mb-ereg-replace-callback.php2024-06-13 02:01 12K 
[   ]mongodb-driver-clientencryption.rewrapmanydatakey.php2024-06-13 02:01 12K 
[   ]function.stripos.php2024-06-13 02:01 12K 
[   ]function.openssl-x509-verify.php2024-06-13 02:01 12K 
[   ]function.eio-read.php2024-06-13 02:01 12K 
[   ]function.ldap-exop.php2024-06-13 02:01 12K 
[   ]function.db2-statistics.php2024-06-13 02:01 12K 
[   ]class.evchild.php2024-06-13 02:01 12K 
[   ]function.imagesetstyle.php2024-06-13 02:01 12K 
[   ]mysqli.quickstart.dual-interface.php2024-06-13 02:01 12K 
[   ]function.strtr.php2024-06-13 02:01 12K 
[   ]function.imap-headerinfo.php2024-06-13 02:01 12K 
[   ]mongodb-bson-document.torelaxedextendedjson.php2024-06-13 02:01 12K 
[   ]phardata.buildfromiterator.php2024-06-13 02:01 12K 
[   ]domxpath.query.php2024-06-13 02:01 12K 
[   ]eventhttp.accept.php2024-06-13 02:01 12K 
[   ]faq.com.php2024-06-13 02:01 12K 
[   ]function.debug-backtrace.php2024-06-13 02:01 12K 
[   ]phar.compressfiles.php2024-06-13 02:01 12K 
[   ]intldateformatter.parse.php2024-06-13 02:01 12K 
[   ]function.define.php2024-06-13 02:01 12K 
[   ]function.array-intersect-ukey.php2024-06-13 02:01 12K 
[   ]function.array-uintersect-uassoc.php2024-06-13 02:01 12K 
[   ]function.pg-fetch-object.php2024-06-13 02:01 12K 
[   ]language.types.callable.php2024-06-13 02:01 12K 
[   ]function.array-diff.php2024-06-13 02:01 12K 
[   ]mysqli-stmt.affected-rows.php2024-06-13 02:01 12K 
[   ]function.filter-var-array.php2024-06-13 02:01 12K 
[   ]function.sqlsrv-fetch-object.php2024-06-13 02:01 12K 
[   ]function.imagefilledpolygon.php2024-06-13 02:01 12K 
[   ]function.array-diff-uassoc.php2024-06-13 02:01 12K 
[   ]mongodb-driver-bulkwrite.delete.php2024-06-13 02:01 12K 
[   ]function.imagecolorclosest.php2024-06-13 02:01 12K 
[   ]function.cubrid-connect.php2024-06-13 02:01 12K 
[   ]mysqli-result.lengths.php2024-06-13 02:01 12K 
[   ]pdostatement.debugdumpparams.php2024-06-13 02:01 12K 
[   ]function.yaml-emit.php2024-06-13 02:01 12K 
[   ]mysqli-stmt.error.php2024-06-13 02:01 12K 
[   ]function.mqseries-get.php2024-06-13 02:01 12K 
[   ]intldateformatter.getlocale.php2024-06-13 02:01 12K 
[   ]numberformatter.formatcurrency.php2024-06-13 02:01 12K 
[   ]posix.constants.setrlimit.php2024-06-13 02:01 12K 
[   ]pdo.construct.php2024-06-13 02:01 12K 
[   ]oci8.connection.php2024-06-13 02:01 12K 
[   ]function.pg-insert.php2024-06-13 02:01 12K 
[   ]function.is-numeric.php2024-06-13 02:01 12K 
[   ]function.eio-readlink.php2024-06-13 02:01 12K 
[   ]function.file.php2024-06-13 02:01 12K 
[   ]zmqpoll.poll.php2024-06-13 02:01 12K 
[   ]recursivefilteriterator.construct.php2024-06-13 02:01 12K 
[   ]phar.converttoexecutable.php2024-06-13 02:01 12K 
[   ]imagickdraw.ellipse.php2024-06-13 02:01 12K 
[   ]function.oci-error.php2024-06-13 02:01 12K 
[   ]datetimezone.gettransitions.php2024-06-13 02:01 12K 
[   ]numberformatter.create.php2024-06-13 02:01 12K 
[   ]class.ui-area.php2024-06-13 02:01 12K 
[   ]phar.decompressfiles.php2024-06-13 02:01 12K 
[   ]function.runkit7-method-redefine.php2024-06-13 02:01 12K 
[   ]function.ps-rotate.php2024-06-13 02:01 12K 
[   ]phardata.converttoexecutable.php2024-06-13 02:01 12K 
[   ]function.sqlsrv-connect.php2024-06-13 02:01 12K 
[   ]random-randomizer.pickarraykeys.php2024-06-13 02:01 12K 
[   ]mysqli-stmt.errno.php2024-06-13 02:01 12K 
[   ]class.mongodb-driver-exception-writeexception.php2024-06-13 02:01 12K 
[   ]expect.examples-usage.php2024-06-13 02:01 12K 
[   ]errorfunc.constants.php2024-06-13 02:01 12K 
[   ]ds-set.add.php2024-06-13 02:01 12K 
[TXT]datetimeimmutable.sub.php2024-06-13 02:01 12K 
[   ]function.db2-procedure-columns.php2024-06-13 02:01 12K 
[   ]function.mysql-data-seek.php2024-06-13 02:01 12K 
[   ]function.token-get-all.php2024-06-13 02:01 12K 
[   ]function.cubrid-pconnect.php2024-06-13 02:01 12K 
[   ]function.strptime.php2024-06-13 02:01 12K 
[   ]array.constants.php2024-06-13 02:01 12K 
[   ]class.messageformatter.php2024-06-13 02:01 12K 
[   ]function.mysql-fetch-object.php2024-06-13 02:01 12K 
[   ]datetimeimmutable.settime.php2024-06-13 02:01 12K 
[   ]numberformatter.settextattribute.php2024-06-13 02:01 12K 
[   ]function.imagelayereffect.php2024-06-13 02:01 12K 
[   ]function.curl-multi-info-read.php2024-06-13 02:01 12K 
[   ]imagick.forwardfouriertransformimage.php2024-06-13 02:01 12K 
[   ]function.array-uintersect-assoc.php2024-06-13 02:01 12K 
[   ]function.openssl-seal.php2024-06-13 02:01 12K 
[   ]function.msg-receive.php2024-06-13 02:01 12K 
[   ]mongodb-driver-server.executewritecommand.php2024-06-13 02:01 12K 
[   ]wkhtmltox-pdf-object.construct.php2024-06-13 02:01 12K 
[   ]function.odbc-procedurecolumns.php2024-06-13 02:01 12K 
[   ]function.iconv-mime-encode.php2024-06-13 02:01 12K 
[   ]class.vtiful-kernel-excel.php2024-06-13 02:01 12K 
[   ]mongodb-driver-server.executereadwritecommand.php2024-06-13 02:01 12K 
[   ]function.cubrid-fetch-object.php2024-06-13 02:01 12K 
[   ]function.mb-convert-case.php2024-06-13 02:01 12K 
[   ]class.yaf-router.php2024-06-13 02:01 12K 
[   ]function.in-array.php2024-06-13 02:01 12K 
[   ]ziparchive.addglob.php2024-06-13 02:01 12K 
[   ]pdostatement.bindcolumn.php2024-06-13 02:01 12K 
[   ]mysqli-stmt.data-seek.php2024-06-13 02:01 12K 
[   ]imagickdraw.composite.php2024-06-13 02:01 12K 
[   ]reflectionparameter.gettype.php2024-06-13 02:01 12K 
[   ]function.imagexbm.php2024-06-13 02:01 12K 
[   ]sqlite3stmt.bindvalue.php2024-06-13 02:01 12K 
[   ]class.evsignal.php2024-06-13 02:01 12K 
[   ]class.mongodb-bson-packedarray.php2024-06-13 02:01 12K 
[   ]function.imageconvolution.php2024-06-13 02:01 12K 
[   ]function.gmmktime.php2024-06-13 02:01 12K 
[   ]function.sscanf.php2024-06-13 02:01 12K 
[   ]function.sqlsrv-query.php2024-06-13 02:01 12K 
[   ]function.idate.php2024-06-13 02:01 12K 
[   ]function.func-get-args.php2024-06-13 02:01 12K 
[   ]function.array.php2024-06-13 02:01 12K 
[   ]function.db2-fetch-both.php2024-06-13 02:01 12K 
[   ]imagick.distortimage.php2024-06-13 02:01 12K 
[   ]function.odbc-columns.php2024-06-13 02:01 12K 
[   ]phardata.compressfiles.php2024-06-13 02:01 12K 
[   ]quickhash.examples.php2024-06-13 02:01 12K 
[   ]function.mysql-fetch-assoc.php2024-06-13 02:01 12K 
[   ]phardata.decompressfiles.php2024-06-13 02:01 12K 
[   ]function.version-compare.php2024-06-13 02:01 12K 
[   ]imagickpixel.construct.php2024-06-13 02:01 12K 
[   ]function.strcspn.php2024-06-13 02:01 12K 
[   ]class.arrayaccess.php2024-06-13 02:01 12K 
[   ]mysqli-result.fetch-all.php2024-06-13 02:01 12K 
[   ]class.yaf-response-abstract.php2024-06-13 02:01 12K 
[   ]imagickdraw.pathstart.php2024-06-13 02:01 12K 
[   ]numberformatter.gettextattribute.php2024-06-13 02:01 12K 
[   ]function.iptcembed.php2024-06-13 02:01 12K 
[   ]class.solrcollapsefunction.php2024-06-13 02:01 12K 
[   ]class.splpriorityqueue.php2024-06-13 02:01 12K 
[   ]book.stats.php2024-06-13 02:01 12K 
[   ]mysqli-result.fetch-row.php2024-06-13 02:01 12K 
[   ]function.runkit7-method-add.php2024-06-13 02:01 12K 
[   ]function.imap-fetch-overview.php2024-06-13 02:01 12K 
[   ]function.eio-grp.php2024-06-13 02:01 12K 
[   ]function.ftp-nb-put.php2024-06-13 02:01 12K 
[   ]phar.compress.php2024-06-13 02:01 12K 
[   ]mongodb-driver-server.executebulkwrite.php2024-06-13 02:01 12K 
[   ]session.upload-progress.php2024-06-13 02:01 12K 
[   ]filters.convert.php2024-06-13 02:01 12K 
[   ]mysqli.options.php2024-06-13 02:01 12K 
[   ]function.imagegd2.php2024-06-13 02:01 12K 
[   ]function.mysql-field-type.php2024-06-13 02:01 12K 
[   ]function.pg-connect.php2024-06-13 02:01 12K 
[   ]numberformatter.setattribute.php2024-06-13 02:01 12K 
[   ]rarentry.extract.php2024-06-13 02:01 11K 
[   ]class.volatile.php2024-06-13 02:01 11K 
[   ]function.socket-set-option.php2024-06-13 02:01 11K 
[   ]eventhttpconnection.makerequest.php2024-06-13 02:01 11K 
[   ]class.mongodb-driver-monitoring-sdamsubscriber.php2024-06-13 02:01 11K 
[   ]gearmanclient.addtaskhigh.php2024-06-13 02:01 11K 
[   ]book.stream.php2024-06-13 02:01 11K 
[   ]mysqlinfo.api.choosing.php2024-06-13 02:01 11K 
[   ]phar.converttodata.php2024-06-13 02:01 11K 
[   ]gearmanclient.addtasklow.php2024-06-13 02:01 11K 
[   ]class.mongodb-driver-exception-runtimeexception.php2024-06-13 02:01 11K 
[   ]function.each.php2024-06-13 02:01 11K 
[   ]stream.examples.php2024-06-13 02:01 11K 
[   ]class.xsltprocessor.php2024-06-13 02:01 11K 
[   ]imagick.floodfillpaintimage.php2024-06-13 02:01 11K 
[   ]ref.stats.php2024-06-13 02:01 11K 
[   ]class.mongodb-driver-topologydescription.php2024-06-13 02:01 11K 
[   ]function.db2-client-info.php2024-06-13 02:01 11K 
[   ]function.gmp-setbit.php2024-06-13 02:01 11K 
[   ]function.array-uintersect.php2024-06-13 02:01 11K 
[   ]intlchar.chartype.php2024-06-13 02:01 11K 
[   ]function.imagesetinterpolation.php2024-06-13 02:01 11K 
[   ]mongodb-driver-clientencryption.construct.php2024-06-13 02:01 11K 
[   ]sqlite3.openblob.php2024-06-13 02:01 11K 
[   ]function.mb-convert-encoding.php2024-06-13 02:01 11K 
[   ]intldateformatter.getdatetype.php2024-06-13 02:01 11K 
[   ]password.constants.php2024-06-13 02:01 11K 
[   ]intldateformatter.gettimetype.php2024-06-13 02:01 11K 
[   ]function.imagesetpixel.php2024-06-13 02:01 11K 
[   ]book.openssl.php2024-06-13 02:01 11K 
[   ]intldateformatter.setpattern.php2024-06-13 02:01 11K 
[   ]function.array-diff-assoc.php2024-06-13 02:01 11K 
[   ]function.eio-fstat.php2024-06-13 02:01 11K 
[   ]intldateformatter.localtime.php2024-06-13 02:01 11K 
[   ]function.pcntl-signal.php2024-06-13 02:01 11K 
[   ]function.eio-mknod.php2024-06-13 02:01 11K 
[   ]class.tidynode.php2024-06-13 02:01 11K 
[   ]functions.first_class_callable_syntax.php2024-06-13 02:01 11K 
[   ]class.commonmark-node-orderedlist.php2024-06-13 02:01 11K 
[   ]functions.variable-functions.php2024-06-13 02:01 11K 
[TXT]seaslog.log.php2024-06-13 02:01 11K 
[   ]class.multipleiterator.php2024-06-13 02:01 11K 
[   ]function.pspell-new-personal.php2024-06-13 02:01 11K 
[   ]function.imagefilltoborder.php2024-06-13 02:01 11K 
[   ]control-structures.for.php2024-06-13 02:01 11K 
[   ]function.eio-open.php2024-06-13 02:01 11K 
[   ]yaf.configuration.php2024-06-13 02:01 11K 
[   ]imagick.setoption.php2024-06-13 02:01 11K 
[   ]class.iterator.php2024-06-13 02:01 11K 
[   ]mysqli.kill.php2024-06-13 02:01 11K 
[   ]mongodb-driver-manager.executewritecommand.php2024-06-13 02:01 11K 
[   ]function.current.php2024-06-13 02:01 11K 
[   ]class.varnishadmin.php2024-06-13 02:01 11K 
[   ]function.wincache-ucache-delete.php2024-06-13 02:01 11K 
[   ]function.substr-compare.php2024-06-13 02:01 11K 
[   ]phardata.converttodata.php2024-06-13 02:01 11K 
[   ]imagickdraw.setstrokelinejoin.php2024-06-13 02:01 11K 
[   ]simplexmlelement.addchild.php2024-06-13 02:01 11K 
[   ]class.callbackfilteriterator.php2024-06-13 02:01 11K 
[   ]function.cubrid-drop.php2024-06-13 02:01 11K 
[   ]class.zmqsocket.php2024-06-13 02:01 11K 
[   ]function.wincache-ucache-info.php2024-06-13 02:01 11K 
[   ]function.eio-grp-add.php2024-06-13 02:01 11K 
[   ]function.socket-bind.php2024-06-13 02:01 11K 
[   ]function.ps-begin-template.php2024-06-13 02:01 11K 
[   ]eventhttprequest.construct.php2024-06-13 02:01 11K 
[   ]mongodb-driver-manager.executereadwritecommand.php2024-06-13 02:01 11K 
[   ]function.array-replace-recursive.php2024-06-13 02:01 11K 
[   ]imagick.importimagepixels.php2024-06-13 02:01 11K 
[   ]pcre.constants.php2024-06-13 02:01 11K 
[   ]pdo.quote.php2024-06-13 02:01 11K 
[   ]function.strripos.php2024-06-13 02:01 11K 
[   ]function.cubrid-put.php2024-06-13 02:01 11K 
[   ]language.operators.assignment.php2024-06-13 02:01 11K 
[   ]class.thread.php2024-06-13 02:01 11K 
[   ]function.win32-start-service-ctrl-dispatcher.php2024-06-13 02:01 11K 
[   ]class.solrpingresponse.php2024-06-13 02:01 11K 
[   ]function.func-get-arg.php2024-06-13 02:01 11K 
[   ]intlcalendar.fielddifference.php2024-06-13 02:01 11K 
[   ]pdo.connections.php2024-06-13 02:01 11K 
[   ]imagick.resizeimage.php2024-06-13 02:01 11K 
[   ]numberformatter.setsymbol.php2024-06-13 02:01 11K 
[   ]numberformatter.getattribute.php2024-06-13 02:01 11K 
[   ]splfileobject.fgetcsv.php2024-06-13 02:01 11K 
[   ]function.pg-field-prtlen.php2024-06-13 02:01 11K 
[   ]class.seekableiterator.php2024-06-13 02:01 11K 
[   ]function.pg-send-prepare.php2024-06-13 02:01 11K 
[   ]class.v8jsexception.php2024-06-13 02:01 11K 
[   ]function.db2-fetch-assoc.php2024-06-13 02:01 11K 
[   ]outcontrol.configuration.php2024-06-13 02:01 11K 
[   ]mysqli.set-charset.php2024-06-13 02:01 11K 
[   ]language.namespaces.basics.php2024-06-13 02:01 11K 
[   ]intlcalendar.settimezone.php2024-06-13 02:01 11K 
[   ]function.snmpset.php2024-06-13 02:01 11K 
[   ]function.natsort.php2024-06-13 02:01 11K 
[   ]function.db2-fetch-array.php2024-06-13 02:01 11K 
[   ]domdocument.createelement.php2024-06-13 02:01 11K 
[   ]function.pg-update.php2024-06-13 02:01 11K 
[   ]function.getrusage.php2024-06-13 02:01 11K 
[   ]imagickdraw.setstrokemiterlimit.php2024-06-13 02:01 11K 
[   ]function.sqlsrv-begin-transaction.php2024-06-13 02:01 11K 
[   ]function.array-unshift.php2024-06-13 02:01 11K 
[   ]mongodb-driver-clientencryption.createdatakey.php2024-06-13 02:01 11K 
[   ]mysqli.configuration.php2024-06-13 02:01 11K 
[   ]class.yaf-view-simple.php2024-06-13 02:01 11K 
[   ]function.cubrid-lob2-seek.php2024-06-13 02:01 11K 
[   ]class.limititerator.php2024-06-13 02:01 11K 
[   ]function.sapi-windows-vt100-support.php2024-06-13 02:01 11K 
[   ]function.pg-query-params.php2024-06-13 02:01 11K 
[   ]migration72.deprecated.php2024-06-13 02:01 11K 
[   ]memcache.setserverparams.php2024-06-13 02:01 11K 
[   ]function.is-callable.php2024-06-13 02:01 11K 
[   ]function.clearstatcache.php2024-06-13 02:01 11K 
[   ]function.db2-columns.php2024-06-13 02:01 11K 
[   ]imagickdraw.pathcurvetoquadraticbezierabsolute.php2024-06-13 02:01 11K 
[   ]function.ksort.php2024-06-13 02:01 11K 
[   ]yar-concurrent-client.loop.php2024-06-13 02:01 11K 
[   ]function.error-log.php2024-06-13 02:01 11K 
[   ]intldateformatter.getcalendar.php2024-06-13 02:01 11K 
[   ]function.snmp2-set.php2024-06-13 02:01 11K 
[   ]function.strspn.php2024-06-13 02:01 11K 
[   ]reserved.keywords.php2024-06-13 02:01 11K 
[   ]memcache.ini.php2024-06-13 02:01 11K 
[   ]function.openssl-pkcs7-encrypt.php2024-06-13 02:01 11K 
[   ]class.exception.php2024-06-13 02:01 11K 
[   ]function.ibase-service-attach.php2024-06-13 02:01 11K 
[   ]function.sqlsrv-commit.php2024-06-13 02:01 11K 
[   ]pdostatement.bindvalue.php2024-06-13 02:01 11K 
[   ]function.db2-autocommit.php2024-06-13 02:01 11K 
[   ]function.phpversion.php2024-06-13 02:01 11K 
[   ]function.glob.php2024-06-13 02:01 11K 
[   ]uopz.constants.php2024-06-13 02:01 11K 
[   ]function.imap-status.php2024-06-13 02:01 11K 
[   ]mysqli-stmt.store-result.php2024-06-13 02:01 11K 
[   ]function.fnmatch.php2024-06-13 02:01 11K 
[   ]function.expect-expectl.php2024-06-13 02:01 11K 
[   ]history.php.php2024-06-13 02:01 11K 
[   ]function.oci-commit.php2024-06-13 02:01 11K 
[   ]simplexmlelement.construct.php2024-06-13 02:01 11K 
[   ]messageformatter.create.php2024-06-13 02:01 11K 
[   ]imagick.deskewimage.php2024-06-13 02:01 11K 
[   ]class.mysql-xdevapi-collection.php2024-06-13 02:01 11K 
[   ]dio.constants.php2024-06-13 02:01 11K 
[   ]function.hash-init.php2024-06-13 02:01 11K 
[   ]numberformatter.getsymbol.php2024-06-13 02:01 11K 
[   ]function.uopz-flags.php2024-06-13 02:01 11K 
[   ]mongodb-driver-server.executereadcommand.php2024-06-13 02:01 11K 
[   ]function.ibase-restore.php2024-06-13 02:01 11K 
[   ]intlcalendar.equals.php2024-06-13 02:01 11K 
[   ]ref.filesystem.php2024-06-13 02:01 11K 
[   ]function.sodium-crypto-secretstream-xchacha20poly1305-init-pull.php2024-06-13 02:01 11K 
[   ]function.unpack.php2024-06-13 02:01 11K 
[   ]language.oop5.abstract.php2024-06-13 02:01 11K 
[   ]tidy.parsestring.php2024-06-13 02:01 11K 
[   ]function.cubrid-field-seek.php2024-06-13 02:01 11K 
[   ]function.serialize.php2024-06-13 02:01 11K 
[   ]faq.obtaining.php2024-06-13 02:01 11K 
[   ]class.evprepare.php2024-06-13 02:01 11K 
[   ]language.constants.syntax.php2024-06-13 02:01 11K 
[   ]intlchar.getpropertyvaluename.php2024-06-13 02:01 11K 
[   ]function.imagepolygon.php2024-06-13 02:01 11K 
[   ]mysqli-stmt.num-rows.php2024-06-13 02:01 11K 
[   ]arrayobject.uasort.php2024-06-13 02:01 11K 
[   ]class.mongodb-driver-exception-commandexception.php2024-06-13 02:01 11K 
[   ]class.error.php2024-06-13 02:01 11K 
[   ]mysqli.insert-id.php2024-06-13 02:01 11K 
[TXT]mongodb.tutorial.library.php2024-06-13 02:01 11K 
[   ]language.types.numeric-strings.php2024-06-13 02:01 11K 
[   ]function.mdecrypt-generic.php2024-06-13 02:01 11K 
[   ]function.readdir.php2024-06-13 02:01 11K 
[   ]function.eio-symlink.php2024-06-13 02:01 11K 
[   ]random-randomizer.nextfloat.php2024-06-13 02:01 11K 
[   ]function.stream-filter-append.php2024-06-13 02:01 11K 
[   ]tutorial.useful.php2024-06-13 02:01 11K 
[   ]mysqli-stmt.field-count.php2024-06-13 02:01 11K 
[   ]outcontrol.constants.php2024-06-13 02:01 11K 
[   ]function.imageantialias.php2024-06-13 02:01 11K 
[   ]yar.examples.php2024-06-13 02:01 11K 
[   ]function.openlog.php2024-06-13 02:01 11K 
[   ]function.stristr.php2024-06-13 02:01 11K 
[   ]function.uopz-set-mock.php2024-06-13 02:01 11K 
[   ]class.swoole-http-response.php2024-06-13 02:01 11K 
[   ]mysqli.thread-id.php2024-06-13 02:01 11K 
[   ]function.pg-prepare.php2024-06-13 02:01 11K 
[   ]function.session-set-cookie-params.php2024-06-13 02:01 11K 
[   ]function.imap-delete.php2024-06-13 02:01 11K 
[   ]function.ldap-add.php2024-06-13 02:01 11K 
[   ]book.zip.php2024-06-13 02:01 11K 
[   ]book.imap.php2024-06-13 02:01 11K 
[   ]function.mt-rand.php2024-06-13 02:01 11K 
[   ]function.stream-socket-recvfrom.php2024-06-13 02:01 11K 
[   ]mysqli-result.num-rows.php2024-06-13 02:01 11K 
[   ]function.ldap-compare.php2024-06-13 02:01 11K 
[   ]ref.pdo-sqlsrv.php2024-06-13 02:01 11K 
[   ]class.evcheck.php2024-06-13 02:01 11K 
[   ]function.sqlsrv-fetch.php2024-06-13 02:01 11K 
[   ]function.pg-send-execute.php2024-06-13 02:01 11K 
[   ]tidy.parsefile.php2024-06-13 02:01 11K 
[   ]language.enumerations.backed.php2024-06-13 02:01 11K 
[   ]faq.mailinglist.php2024-06-13 02:01 11K 
[   ]class.commonmark-node-codeblock.php2024-06-13 02:01 11K 
[   ]function.exec.php2024-06-13 02:01 11K 
[   ]function.openssl-open.php2024-06-13 02:01 11K 
[   ]function.imagegd.php2024-06-13 02:01 11K 
[   ]pdo.sqlitecreatefunction.php2024-06-13 02:01 11K 
[   ]streamwrapper.url-stat.php2024-06-13 02:01 11K 
[   ]numberformatter.parse.php2024-06-13 02:01 11K 
[   ]function.pg-execute.php2024-06-13 02:01 11K 
[   ]intlchar.chardirection.php2024-06-13 02:01 11K 
[   ]function.ibase-connect.php2024-06-13 02:01 11K 
[   ]function.imagecropauto.php2024-06-13 02:01 11K 
[   ]pdo.transactions.php2024-06-13 02:01 11K 
[   ]install.macosx.bundled.php2024-06-13 02:01 11K 
[   ]class.ui-draw-path.php2024-06-13 02:01 11K 
[   ]phar.setstub.php2024-06-13 02:01 11K 
[   ]function.libxml-get-errors.php2024-06-13 02:01 11K 
[   ]tidy.repairfile.php2024-06-13 02:01 11K 
[   ]datetimezone.construct.php2024-06-13 02:01 11K 
[   ]function.imagerectangle.php2024-06-13 02:01 11K 
[   ]simplexmlelement.addattribute.php2024-06-13 02:01 11K 
[   ]intlcalendar.getdayofweektype.php2024-06-13 02:01 10K 
[   ]reflectionproperty.setvalue.php2024-06-13 02:01 10K 
[   ]gearman.examples-reverse-bg.php2024-06-13 02:01 10K 
[   ]class.commonmark-node-image.php2024-06-13 02:01 10K 
[   ]solrclient.adddocuments.php2024-06-13 02:01 10K 
[   ]function.ldap-exop-passwd.php2024-06-13 02:01 10K 
[   ]class.commonmark-node-link.php2024-06-13 02:01 10K 
[   ]mongodb-driver-cursor.isdead.php2024-06-13 02:01 10K 
[   ]function.ftp-nb-fget.php2024-06-13 02:01 10K 
[   ]configuration.file.php2024-06-13 02:01 10K 
[   ]normalizer.isnormalized.php2024-06-13 02:01 10K 
[   ]function.ibase-backup.php2024-06-13 02:01 10K 
[   ]mongodb-driver-server.getinfo.php2024-06-13 02:01 10K 
[   ]random-engine.generate.php2024-06-13 02:01 10K 
[   ]random-engine-pcgoneseq128xslrr64.jump.php2024-06-13 02:01 10K 
[   ]language.oop5.anonymous.php2024-06-13 02:01 10K 
[   ]xml.constants.php2024-06-13 02:01 10K 
[   ]function.uasort.php2024-06-13 02:01 10K 
[   ]function.wincache-ucache-get.php2024-06-13 02:01 10K 
[   ]function.oci-field-type.php2024-06-13 02:01 10K 
[   ]mysqlnd.plugin.developing.php2024-06-13 02:01 10K 
[   ]messageformatter.setpattern.php2024-06-13 02:01 10K 
[   ]datetimeimmutable.add.php2024-06-13 02:01 10K 
[   ]reflectionclass.getmethods.php2024-06-13 02:01 10K 
[   ]migration81.other-changes.php2024-06-13 02:01 10K 
[   ]stomp.examples.php2024-06-13 02:01 10K 
[   ]function.preg-replace-callback-array.php2024-06-13 02:01 10K 
[   ]class.commonmark-node-bulletlist.php2024-06-13 02:01 10K 
[   ]function.sqlsrv-rollback.php2024-06-13 02:01 10K 
[   ]collator.compare.php2024-06-13 02:01 10K 
[   ]class.reflectionextension.php2024-06-13 02:01 10K 
[   ]class.random-randomizer.php2024-06-13 02:01 10K 
[   ]function.imageopenpolygon.php2024-06-13 02:01 10K 
[   ]pdo.error-handling.php2024-06-13 02:01 10K 
[   ]imagickdraw.setgravity.php2024-06-13 02:01 10K 
[   ]function.array-intersect-key.php2024-06-13 02:01 10K 
[   ]recursiveregexiterator.construct.php2024-06-13 02:01 10K 
[   ]function.imagecolorat.php2024-06-13 02:01 10K 
[   ]function.db2-prepare.php2024-06-13 02:01 10K 
[   ]dba.installation.php2024-06-13 02:01 10K 
[   ]mongodb-driver-writeconcern.construct.php2024-06-13 02:01 10K 
[   ]function.simplexml-load-file.php2024-06-13 02:01 10K 
[   ]language.attributes.overview.php2024-06-13 02:01 10K 
[   ]function.libxml-set-external-entity-loader.php2024-06-13 02:01 10K 
[   ]rararchive.getentries.php2024-06-13 02:01 10K 
[   ]function.rand.php2024-06-13 02:01 10K 
[   ]function.ini-get.php2024-06-13 02:01 10K 
[   ]function.sodium-crypto-pwhash.php2024-06-13 02:01 10K 
[   ]book.filesystem.php2024-06-13 02:01 10K 
[   ]mysqli.field-count.php2024-06-13 02:01 10K 
[   ]function.simdjson-is-valid.php2024-06-13 02:01 10K 
[   ]class.eventhttpconnection.php2024-06-13 02:01 10K 
[   ]class.mysql-xdevapi-collectionmodify.php2024-06-13 02:01 10K 
[   ]mongodb-driver-readpreference.bsonserialize.php2024-06-13 02:01 10K 
[   ]function.iconv-mime-decode-headers.php2024-06-13 02:01 10K 
[   ]normalizer.getrawdecomposition.php2024-06-13 02:01 10K 
[   ]control-structures.declare.php2024-06-13 02:01 10K 
[   ]imagickdraw.pathcurvetoquadraticbeziersmoothrelative.php2024-06-13 02:01 10K 
[   ]function.pg-pconnect.php2024-06-13 02:01 10K 
[   ]memcached.get.php2024-06-13 02:01 10K 
[   ]function.imagestring.php2024-06-13 02:01 10K 
[   ]function.ftp-nb-fput.php2024-06-13 02:01 10K 
[   ]function.finfo-open.php2024-06-13 02:01 10K 
[   ]function.fputcsv.php2024-06-13 02:01 10K 
[   ]class.resourcebundle.php2024-06-13 02:01 10K 
[   ]function.com-event-sink.php2024-06-13 02:01 10K 
[   ]quickhashstringinthash.loadfromfile.php2024-06-13 02:01 10K 
[   ]function.preg-filter.php2024-06-13 02:01 10K 
[   ]inotify.constants.php2024-06-13 02:01 10K 
[   ]function.mysql-db-query.php2024-06-13 02:01 10K 
[   ]parle.examples.lexer.php2024-06-13 02:01 10K 
[   ]class.pdoexception.php2024-06-13 02:01 10K 
[   ]quickhashinthash.add.php2024-06-13 02:01 10K 
[   ]function.imagechar.php2024-06-13 02:01 10K 
[   ]soapclient.dorequest.php2024-06-13 02:01 10K 
[   ]datetime.gettimestamp.php2024-06-13 02:01 10K 
[   ]function.session-create-id.php2024-06-13 02:01 10K 
[   ]function.curl-multi-exec.php2024-06-13 02:01 10K 
[   ]intlcalendar.getrepeatedwalltimeoption.php2024-06-13 02:01 10K 
[   ]intldateformatter.getpattern.php2024-06-13 02:01 10K 
[   ]functions.arrow.php2024-06-13 02:01 10K 
[   ]function.sqlsrv-cancel.php2024-06-13 02:01 10K 
[   ]imagickdraw.setviewbox.php2024-06-13 02:01 10K 
[   ]function.snmp3-walk.php2024-06-13 02:01 10K 
[   ]arrayobject.uksort.php2024-06-13 02:01 10K 
[   ]function.socket-sendto.php2024-06-13 02:01 10K 
[   ]ziparchive.addfile.php2024-06-13 02:01 10K 
[   ]function.eio-custom.php2024-06-13 02:01 10K 
[   ]function.ini-get-all.php2024-06-13 02:01 10K 
[   ]function.parse-str.php2024-06-13 02:01 10K 
[   ]function.cubrid-seq-insert.php2024-06-13 02:01 10K 
[   ]function.pg-fetch-row.php2024-06-13 02:01 10K 
[   ]phar.mount.php2024-06-13 02:01 10K 
[   ]language.variables.variable.php2024-06-13 02:01 10K 
[   ]function.sodium-crypto-secretstream-xchacha20poly1305-init-push.php2024-06-13 02:01 10K 
[   ]mongodb-driver-manager.executereadcommand.php2024-06-13 02:01 10K 
[   ]imagickdraw.pathcurvetoquadraticbeziersmoothabsolute.php2024-06-13 02:01 10K 
[   ]function.pg-delete.php2024-06-13 02:01 10K 
[   ]event.add.php2024-06-13 02:01 10K 
[   ]faq.passwords.php2024-06-13 02:01 10K 
[   ]class.mongodb-driver-writeconcern.php2024-06-13 02:01 10K 
[   ]function.pg-send-query.php2024-06-13 02:01 10K 
[   ]function.shmop-open.php2024-06-13 02:01 10K 
[   ]function.simplexml-load-string.php2024-06-13 02:01 10K 
[   ]function.curl-share-setopt.php2024-06-13 02:01 10K 
[   ]function.oci-field-size.php2024-06-13 02:01 10K 
[   ]function.cubrid-prepare.php2024-06-13 02:01 10K 
[   ]class.mongodb-driver-exception-executiontimeoutexception.php2024-06-13 02:01 10K 
[   ]function.cubrid-seq-put.php2024-06-13 02:01 10K 
[   ]function.db2-special-columns.php2024-06-13 02:01 10K 
[   ]function.imagecopymergegray.php2024-06-13 02:01 10K 
[   ]function.boolval.php2024-06-13 02:01 10K 
[   ]function.readfile.php2024-06-13 02:01 10K 
[   ]function.mb-convert-kana.php2024-06-13 02:01 10K 
[   ]seaslog.setrequestvariable.php2024-06-13 02:01 10K 
[   ]numberformatter.format.php2024-06-13 02:01 10K 
[   ]yaml.constants.php2024-06-13 02:01 10K 
[   ]function.imageellipse.php2024-06-13 02:01 10K 
[   ]arrayobject.asort.php2024-06-13 02:01 10K 
[   ]imagickdraw.setstrokeopacity.php2024-06-13 02:01 10K 
[   ]class.componere-definition.php2024-06-13 02:01 10K 
[   ]function.ps-makespotcolor.php2024-06-13 02:01 10K 
[   ]imagick.setprogressmonitor.php2024-06-13 02:01 10K 
[   ]ssh2.constants.php2024-06-13 02:01 10K 
[   ]soapserver.setpersistence.php2024-06-13 02:01 10K 
[   ]function.imagecolorallocate.php2024-06-13 02:01 10K 
[   ]function.imap-fetchstructure.php2024-06-13 02:01 10K 
[   ]migration82.incompatible.php2024-06-13 02:01 10K 
[   ]mysqli.ping.php2024-06-13 02:01 10K 
[   ]function.ldap-connect.php2024-06-13 02:01 10K 
[   ]function.dl.php2024-06-13 02:01 10K 
[   ]function.curl-multi-add-handle.php2024-06-13 02:01 10K 
[   ]function.pg-convert.php2024-06-13 02:01 10K 
[   ]function.sqlsrv-get-field.php2024-06-13 02:01 10K 
[   ]function.ftp-fget.php2024-06-13 02:01 10K 
[   ]function.runkit7-function-redefine.php2024-06-13 02:01 10K 
[   ]tidy.repairstring.php2024-06-13 02:01 10K 
[   ]locale.lookup.php2024-06-13 02:01 10K 
[   ]class.solrexception.php2024-06-13 02:01 10K 
[   ]filter.examples.validation.php2024-06-13 02:01 10K 
[   ]function.sqlsrv-execute.php2024-06-13 02:01 10K 
[   ]yar-concurrent-client.call.php2024-06-13 02:01 10K 
[   ]class.transliterator.php2024-06-13 02:01 10K 
[   ]function.array-key-exists.php2024-06-13 02:01 10K 
[   ]function.array-reduce.php2024-06-13 02:01 9.9K 
[   ]class.mongodb-driver-monitoring-logsubscriber.php2024-06-13 02:01 9.9K 
[   ]mysql-xdevapi.examples.php2024-06-13 02:01 9.9K 
[   ]function.odbc-statistics.php2024-06-13 02:01 9.9K 
[   ]com.construct.php2024-06-13 02:01 9.9K 
[   ]appenditerator.construct.php2024-06-13 02:01 9.9K 
[   ]function.gmp-div-q.php2024-06-13 02:01 9.9K 
[   ]quickhashstringinthash.add.php2024-06-13 02:01 9.9K 
[   ]mysqli.close.php2024-06-13 02:01 9.9K 
[   ]function.imagecharup.php2024-06-13 02:01 9.9K 
[   ]function.urlencode.php2024-06-13 02:01 9.9K 
[   ]messageformatter.getpattern.php2024-06-13 02:01 9.9K 
[   ]class.ui-controls-box.php2024-06-13 02:01 9.9K 
[   ]fpm.status.php2024-06-13 02:01 9.9K 
[   ]reflectionparameter.construct.php2024-06-13 02:01 9.9K 
[   ]function.ldap-parse-result.php2024-06-13 02:01 9.9K 
[   ]install.pecl.windows.php2024-06-13 02:01 9.9K 
[   ]soapvar.construct.php2024-06-13 02:01 9.9K 
[   ]class.luasandboxerror.php2024-06-13 02:01 9.9K 
[   ]function.openssl-pkey-get-details.php2024-06-13 02:01 9.9K 
[   ]ref.openssl.php2024-06-13 02:01 9.9K 
[   ]function.pg-result-error-field.php2024-06-13 02:01 9.9K 
[   ]filters.string.php2024-06-13 02:01 9.9K 
[   ]mysqli.info.php2024-06-13 02:01 9.9K 
[   ]function.ob-get-status.php2024-06-13 02:01 9.9K 
[   ]class.mysqli-sql-exception.php2024-06-13 02:01 9.9K 
[   ]function.dio-fcntl.php2024-06-13 02:01 9.9K 
[   ]function.next.php2024-06-13 02:01 9.9K 
[   ]function.sqlsrv-errors.php2024-06-13 02:01 9.8K 
[   ]function.uksort.php2024-06-13 02:01 9.8K 
[   ]function.ucwords.php2024-06-13 02:01 9.8K 
[   ]class.soapserver.php2024-06-13 02:01 9.8K 
[   ]book.spl.php2024-06-13 02:01 9.8K 
[   ]evperiodic.construct.php2024-06-13 02:01 9.8K 
[   ]function.imap-append.php2024-06-13 02:01 9.8K 
[   ]class.mongodb-driver-exception-bulkwriteexception.php2024-06-13 02:01 9.8K 
[   ]messageformatter.parsemessage.php2024-06-13 02:01 9.8K 
[   ]yaf-router.getcurrentroute.php2024-06-13 02:01 9.8K 
[   ]class.mysql-xdevapi-session.php2024-06-13 02:01 9.8K 
[   ]pdostatement.rowcount.php2024-06-13 02:01 9.8K 
[   ]function.mb-send-mail.php2024-06-13 02:01 9.8K 
[   ]function.array-unique.php2024-06-13 02:01 9.8K 
[   ]function.substr-count.php2024-06-13 02:01 9.8K 
[   ]function.reset.php2024-06-13 02:01 9.8K 
[   ]intro.phar.php2024-06-13 02:01 9.8K 
[   ]function.mb-encode-mimeheader.php2024-06-13 02:01 9.8K 
[   ]class.evembed.php2024-06-13 02:01 9.8K 
[   ]random-engine-xoshiro256starstar.jump.php2024-06-13 02:01 9.8K 
[   ]phar.decompress.php2024-06-13 02:01 9.8K 
[   ]function.wincache-ocache-fileinfo.php2024-06-13 02:01 9.8K 
[   ]function.getdate.php2024-06-13 02:01 9.8K 
[   ]function.imagecreatefromgif.php2024-06-13 02:01 9.8K 
[   ]closure.bindto.php2024-06-13 02:01 9.8K 
[   ]class.evwatcher.php2024-06-13 02:01 9.8K 
[   ]seaslog.constants.php2024-06-13 02:01 9.8K 
[   ]function.cubrid-fetch.php2024-06-13 02:01 9.8K 
[   ]function.yaml-parse.php2024-06-13 02:01 9.8K 
[   ]function.eio-lstat.php2024-06-13 02:01 9.8K 
[   ]stomp.readframe.php2024-06-13 02:01 9.7K 
[   ]function.imagefilledellipse.php2024-06-13 02:01 9.7K 
[   ]function.imagegrabwindow.php2024-06-13 02:01 9.7K 
[   ]function.eio-stat.php2024-06-13 02:01 9.7K 
[   ]seaslog.getrequestvariable.php2024-06-13 02:01 9.7K 
[   ]function.exif-imagetype.php2024-06-13 02:01 9.7K 
[   ]stomp.commit.php2024-06-13 02:01 9.7K 
[   ]pharfileinfo.compress.php2024-06-13 02:01 9.7K 
[   ]arrayobject.ksort.php2024-06-13 02:01 9.7K 
[   ]function.mysql-list-tables.php2024-06-13 02:01 9.7K 
[   ]numberformatter.setpattern.php2024-06-13 02:01 9.7K 
[   ]function.hash-hkdf.php2024-06-13 02:01 9.7K 
[   ]ref.mbstring.php2024-06-13 02:01 9.7K 
[   ]function.stream-socket-pair.php2024-06-13 02:01 9.7K 
[   ]ldap.controls.php2024-06-13 02:01 9.7K 
[   ]function.igbinary-unserialize.php2024-06-13 02:01 9.7K 
[   ]function.localeconv.php2024-06-13 02:01 9.7K 
[   ]stomp.abort.php2024-06-13 02:01 9.7K 
[   ]locale.getdisplaylanguage.php2024-06-13 02:01 9.7K 
[   ]mysql-xdevapi-collection.find.php2024-06-13 02:01 9.7K 
[   ]function.str-ireplace.php2024-06-13 02:01 9.7K 
[   ]function.ldap-bind.php2024-06-13 02:01 9.7K 
[   ]function.imageflip.php2024-06-13 02:01 9.7K 
[   ]class.solrillegaloperationexception.php2024-06-13 02:01 9.7K 
[   ]imagickdraw.setfontfamily.php2024-06-13 02:01 9.7K 
[   ]function.snmp3-real-walk.php2024-06-13 02:01 9.7K 
[   ]locale.getdisplayvariant.php2024-06-13 02:01 9.7K 
[   ]locale.getdisplayname.php2024-06-13 02:01 9.7K 
[   ]function.ibase-server-info.php2024-06-13 02:01 9.7K 
[   ]function.cubrid-get.php2024-06-13 02:01 9.7K 
[   ]imagickdraw.setstrokedashoffset.php2024-06-13 02:01 9.7K 
[   ]function.pcntl-waitpid.php2024-06-13 02:01 9.7K 
[   ]class.ui-controls-multilineentry.php2024-06-13 02:01 9.7K 
[   ]domimplementation.createdocumenttype.php2024-06-13 02:01 9.7K 
[   ]function.array-rand.php2024-06-13 02:01 9.7K 
[   ]class.solrillegalargumentexception.php2024-06-13 02:01 9.7K 
[   ]locale.getdisplayscript.php2024-06-13 02:01 9.7K 
[   ]language.types.float.php2024-06-13 02:01 9.7K 
[   ]mysqlnd.memory.php2024-06-13 02:01 9.7K 
[   ]rararchive.setallowbroken.php2024-06-13 02:01 9.6K 
[   ]locale.getdisplayregion.php2024-06-13 02:01 9.6K 
[   ]function.sodium-crypto-stream-xchacha20-xor-ic.php2024-06-13 02:01 9.6K 
[   ]function.oci-field-name.php2024-06-13 02:01 9.6K 
[   ]function.pspell-new.php2024-06-13 02:01 9.6K 
[   ]function.imagepalettetotruecolor.php2024-06-13 02:01 9.6K 
[   ]function.cubrid-fetch-array.php2024-06-13 02:01 9.6K 
[   ]function.cubrid-seq-drop.php2024-06-13 02:01 9.6K 
[   ]function.pg-fetch-assoc.php2024-06-13 02:01 9.6K 
[   ]gearmanclient.addtaskstatus.php2024-06-13 02:01 9.6K 
[   ]function.openssl-csr-get-subject.php2024-06-13 02:01 9.6K 
[   ]function.dbase-replace-record.php2024-06-13 02:01 9.6K 
[   ]class.commonmark-node-text.php2024-06-13 02:01 9.6K 
[   ]messageformatter.parse.php2024-06-13 02:01 9.6K 
[   ]function.dba-popen.php2024-06-13 02:01 9.6K 
[   ]ziparchive.getstream.php2024-06-13 02:01 9.6K 
[   ]class.evidle.php2024-06-13 02:01 9.6K 
[   ]function.mysql-result.php2024-06-13 02:01 9.6K 
[   ]quickhashintstringhash.add.php2024-06-13 02:01 9.6K 
[   ]function.odbc-procedures.php2024-06-13 02:01 9.6K 
[   ]function.dirname.php2024-06-13 02:01 9.6K 
[   ]rararchive.getentry.php2024-06-13 02:01 9.6K 
[   ]function.oci-set-edition.php2024-06-13 02:01 9.6K 
[   ]reflectionfunction.construct.php2024-06-13 02:01 9.6K 
[   ]function.igbinary-serialize.php2024-06-13 02:01 9.6K 
[   ]class.commonmark-node-heading.php2024-06-13 02:01 9.6K 
[   ]function.get-class-vars.php2024-06-13 02:01 9.6K 
[   ]oauth.examples.fireeagle.php2024-06-13 02:01 9.6K 
[   ]function.output-add-rewrite-var.php2024-06-13 02:01 9.6K 
[   ]function.runkit7-function-add.php2024-06-13 02:01 9.6K 
[   ]language.types.boolean.php2024-06-13 02:01 9.6K 
[   ]runkit7.constants.php2024-06-13 02:01 9.6K 
[   ]reflectionfunction.invokeargs.php2024-06-13 02:01 9.6K 
[   ]function.htmlspecialchars-decode.php2024-06-13 02:01 9.6K 
[   ]function.strip-tags.php2024-06-13 02:01 9.6K 
[   ]soapfault.construct.php2024-06-13 02:01 9.6K 
[   ]mysql-xdevapi-collection.createindex.php2024-06-13 02:01 9.6K 
[   ]class.dateexception.php2024-06-13 02:01 9.5K 
[   ]function.imagecopymerge.php2024-06-13 02:01 9.5K 
[   ]splfileobject.fputcsv.php2024-06-13 02:01 9.5K 
[   ]function.cubrid-lob2-bind.php2024-06-13 02:01 9.5K 
[   ]mysql-xdevapi-columnresult.construct.php2024-06-13 02:01 9.5K 
[   ]mysql-xdevapi-collection.add.php2024-06-13 02:01 9.5K 
[   ]class.solrserverexception.php2024-06-13 02:01 9.5K 
[   ]function.rtrim.php2024-06-13 02:01 9.5K 
[   ]book.mbstring.php2024-06-13 02:01 9.5K 
[   ]function.readline-callback-handler-install.php2024-06-13 02:01 9.5K 
[   ]imagickdraw.setfontstretch.php2024-06-13 02:01 9.5K 
[   ]class.solrclientexception.php2024-06-13 02:01 9.5K 
[   ]messageformatter.format.php2024-06-13 02:01 9.5K 
[   ]memcache.set.php2024-06-13 02:01 9.5K 
[   ]imagickkernel.separate.php2024-06-13 02:01 9.5K 
[   ]function.uopz-set-return.php2024-06-13 02:01 9.5K 
[   ]domdocument.savexml.php2024-06-13 02:01 9.5K 
[   ]random-randomizer.getbytesfromstring.php2024-06-13 02:01 9.5K 
[   ]function.arsort.php2024-06-13 02:01 9.5K 
[   ]mysql.configuration.php2024-06-13 02:01 9.5K 
[   ]install.unix.litespeed.php2024-06-13 02:01 9.5K 
[   ]function.ltrim.php2024-06-13 02:01 9.5K 
[   ]gearmanclient.dobackground.php2024-06-13 02:01 9.5K 
[   ]class.eventhttp.php2024-06-13 02:01 9.5K 
[   ]ziparchive.locatename.php2024-06-13 02:01 9.5K 
[   ]function.asort.php2024-06-13 02:01 9.5K 
[   ]functions.user-defined.php2024-06-13 02:01 9.5K 
[   ]function.msg-send.php2024-06-13 02:01 9.5K 
[   ]imagickdraw.arc.php2024-06-13 02:01 9.5K 
[   ]function.syslog.php2024-06-13 02:01 9.5K 
[   ]mongodb-driver-bulkwrite.insert.php2024-06-13 02:01 9.5K 
[   ]function.pg-fetch-result.php2024-06-13 02:01 9.5K 
[   ]function.random-bytes.php2024-06-13 02:01 9.5K 
[   ]context.socket.php2024-06-13 02:01 9.5K 
[   ]function.imagestringup.php2024-06-13 02:01 9.4K 
[   ]wkhtmltox-image-converter.construct.php2024-06-13 02:01 9.4K 
[   ]class.weakmap.php2024-06-13 02:01 9.4K 
[   ]class.mongodb-driver-exception-connectiontimeoutexception.php2024-06-13 02:01 9.4K 
[   ]class.imagickpixeliterator.php2024-06-13 02:01 9.4K 
[   ]seaslog.analyzerdetail.php2024-06-13 02:01 9.4K 
[   ]yaz.examples.php2024-06-13 02:01 9.4K 
[   ]function.phpinfo.php2024-06-13 02:01 9.4K 
[   ]class.ui-controls-entry.php2024-06-13 02:01 9.4K 
[   ]function.pg-trace.php2024-06-13 02:01 9.4K 
[   ]class.parentiterator.php2024-06-13 02:01 9.4K 
[   ]function.localtime.php2024-06-13 02:01 9.4K 
[   ]function.wincache-scache-info.php2024-06-13 02:01 9.4K 
[   ]function.cubrid-set-add.php2024-06-13 02:01 9.4K 
[   ]oauth.getaccesstoken.php2024-06-13 02:01 9.4K 
[   ]random-engine-xoshiro256starstar.jumplong.php2024-06-13 02:01 9.4K 
[   ]function.fscanf.php2024-06-13 02:01 9.4K 
[   ]function.curl-multi-close.php2024-06-13 02:01 9.4K 
[   ]function.print-r.php2024-06-13 02:01 9.4K 
[   ]function.debug-zval-dump.php2024-06-13 02:01 9.4K 
[   ]transliterator.transliterate.php2024-06-13 02:01 9.4K 
[   ]solrclient.query.php2024-06-13 02:01 9.4K 
[   ]function.eval.php2024-06-13 02:01 9.4K 
[   ]mysqli-stmt.param-count.php2024-06-13 02:01 9.4K 
[   ]function.cubrid-set-drop.php2024-06-13 02:01 9.4K 
[   ]function.fgetss.php2024-06-13 02:01 9.4K 
[   ]function.str-getcsv.php2024-06-13 02:01 9.4K 
[   ]function.imageloadfont.php2024-06-13 02:01 9.4K 
[   ]function.ftp-fput.php2024-06-13 02:01 9.4K 
[   ]function.cubrid-lock-write.php2024-06-13 02:01 9.4K 
[   ]book.ldap.php2024-06-13 02:01 9.4K 
[   ]function.imagecopy.php2024-06-13 02:01 9.4K 
[   ]function.pg-fetch-all.php2024-06-13 02:01 9.4K 
[   ]function.mysql-stat.php2024-06-13 02:01 9.4K 
[   ]intlcalendar.roll.php2024-06-13 02:01 9.4K 
[   ]function.cubrid-move-cursor.php2024-06-13 02:01 9.4K 
[   ]function.error-reporting.php2024-06-13 02:01 9.4K 
[   ]datetimeimmutable.modify.php2024-06-13 02:01 9.4K 
[   ]function.get-debug-type.php2024-06-13 02:01 9.4K 
[   ]class.yac.php2024-06-13 02:01 9.4K 
[   ]function.imap-mailboxmsginfo.php2024-06-13 02:01 9.3K 
[   ]arrayaccess.offsetexists.php2024-06-13 02:01 9.3K 
[   ]ref.ps.php2024-06-13 02:01 9.3K 
[   ]function.prev.php2024-06-13 02:01 9.3K 
[   ]function.imagesetbrush.php2024-06-13 02:01 9.3K 
[   ]function.imagecreatefromjpeg.php2024-06-13 02:01 9.3K 
[   ]collator.asort.php2024-06-13 02:01 9.3K 
[   ]function.random-int.php2024-06-13 02:01 9.3K 
[   ]function.get-headers.php2024-06-13 02:01 9.3K 
[   ]class.mongodb-driver-exception-sslconnectionexception.php2024-06-13 02:01 9.3K 
[   ]parallel.run.php2024-06-13 02:01 9.3K 
[   ]class.typeerror.php2024-06-13 02:01 9.3K 
[   ]function.forward-static-call-array.php2024-06-13 02:01 9.3K 
[   ]function.empty.php2024-06-13 02:01 9.3K 
[   ]mysqli.get-connection-stats.php2024-06-13 02:01 9.3K 
[   ]migration70.constants.php2024-06-13 02:01 9.3K 
[   ]normalizer.normalize.php2024-06-13 02:01 9.3K 
[   ]function.rsort.php2024-06-13 02:01 9.3K 
[   ]function.imagecreatefromwbmp.php2024-06-13 02:01 9.3K 
[   ]function.ps-get-value.php2024-06-13 02:01 9.3K 
[   ]function.ftp-get.php2024-06-13 02:01 9.3K 
[   ]function.snmp-set-valueretrieval.php2024-06-13 02:01 9.3K 
[   ]function.str-word-count.php2024-06-13 02:01 9.3K 
[   ]reserved.variables.globals.php2024-06-13 02:01 9.3K 
[   ]ref.cubrid.php2024-06-13 02:01 9.3K 
[   ]class.commonmark-node-htmlblock.php2024-06-13 02:01 9.3K 
[   ]memcached.cas.php2024-06-13 02:01 9.3K 
[   ]function.imagecolorexactalpha.php2024-06-13 02:01 9.3K 
[   ]function.gd-info.php2024-06-13 02:01 9.3K 
[   ]function.imagecreatefrompng.php2024-06-13 02:01 9.3K 
[   ]numberformatter.parsecurrency.php2024-06-13 02:01 9.3K 
[   ]eventhttpconnection.setclosecallback.php2024-06-13 02:01 9.3K 
[   ]imagickdraw.settextalignment.php2024-06-13 02:01 9.3K 
[   ]class.commonmark-node-htmlinline.php2024-06-13 02:01 9.3K 
[   ]imagickdraw.setcliprule.php2024-06-13 02:01 9.3K 
[   ]pharfileinfo.iscompressed.php2024-06-13 02:01 9.3K 
[   ]function.exit.php2024-06-13 02:01 9.3K 
[   ]regexiterator.construct.php2024-06-13 02:01 9.3K 
[   ]luasandbox.pauseusagetimer.php2024-06-13 02:01 9.2K 
[   ]numberformatter.getpattern.php2024-06-13 02:01 9.2K 
[   ]function.scandir.php2024-06-13 02:01 9.2K 
[   ]function.gmstrftime.php2024-06-13 02:01 9.2K 
[   ]function.cubrid-affected-rows.php2024-06-13 02:01 9.2K 
[   ]class.commonmark-node-code.php2024-06-13 02:01 9.2K 
[   ]function.ps-set-text-pos.php2024-06-13 02:01 9.2K 
[   ]imagickdraw.roundrectangle.php2024-06-13 02:01 9.2K 
[   ]function.ip2long.php2024-06-13 02:01 9.2K 
[   ]mysql-xdevapi-schema.createcollection.php2024-06-13 02:01 9.2K 
[   ]function.stream-wrapper-register.php2024-06-13 02:01 9.2K 
[   ]gnupg.constants.php2024-06-13 02:01 9.2K 
[   ]language.generators.overview.php2024-06-13 02:01 9.2K 
[   ]language.oop5.static.php2024-06-13 02:01 9.2K 
[   ]class.domnamespacenode.php2024-06-13 02:01 9.2K 
[   ]function.pg-field-size.php2024-06-13 02:01 9.2K 
[   ]function.imagepng.php2024-06-13 02:01 9.2K 
[   ]sqlite3.createcollation.php2024-06-13 02:01 9.2K 
[   ]mysqli.quickstart.multiple-statement.php2024-06-13 02:01 9.2K 
[   ]mysqli-result.construct.php2024-06-13 02:01 9.2K 
[   ]zookeeper.get.php2024-06-13 02:01 9.2K 
[   ]function.mkdir.php2024-06-13 02:01 9.2K 
[   ]function.openssl-random-pseudo-bytes.php2024-06-13 02:01 9.2K 
[   ]function.mqseries-inq.php2024-06-13 02:01 9.2K 
[   ]function.yaz-scan.php2024-06-13 02:01 9.2K 
[   ]tidy.construct.php2024-06-13 02:01 9.2K 
[   ]reference.pcre.pattern.modifiers.php2024-06-13 02:01 9.2K 
[   ]function.array-fill.php2024-06-13 02:01 9.2K 
[   ]function.openssl-spki-new.php2024-06-13 02:01 9.2K 
[   ]class.domexception.php2024-06-13 02:01 9.2K 
[   ]function.win32-set-service-status.php2024-06-13 02:01 9.2K 
[   ]function.eio-rename.php2024-06-13 02:01 9.2K 
[   ]oauth.fetch.php2024-06-13 02:01 9.2K 
[   ]class.commonmark-node.php2024-06-13 02:01 9.2K 
[   ]phar.buildfromdirectory.php2024-06-13 02:01 9.2K 
[   ]xmlwriter.writedtdentity.php2024-06-13 02:01 9.2K 
[   ]function.constant.php2024-06-13 02:01 9.2K 
[   ]function.db2-rollback.php2024-06-13 02:01 9.1K 
[   ]function.class-alias.php2024-06-13 02:01 9.1K 
[   ]function.chmod.php2024-06-13 02:01 9.1K 
[   ]function.finfo-file.php2024-06-13 02:01 9.1K 
[   ]function.gmp-gcdext.php2024-06-13 02:01 9.1K 
[   ]function.wincache-fcache-fileinfo.php2024-06-13 02:01 9.1K 
[   ]datetime.settimezone.php2024-06-13 02:01 9.1K 
[   ]security.errors.php2024-06-13 02:01 9.1K 
[   ]mysqli.store-result.php2024-06-13 02:01 9.1K 
[   ]function.imap-get-quotaroot.php2024-06-13 02:01 9.1K 
[   ]locale.filtermatches.php2024-06-13 02:01 9.1K 
[   ]mysqlnd.plugin.api.php2024-06-13 02:01 9.1K 
[   ]function.mysql-field-name.php2024-06-13 02:01 9.1K 
[   ]function.mongodb.bson-tophp.php2024-06-13 02:01 9.1K 
[   ]soapserver.construct.php2024-06-13 02:01 9.1K 
[   ]imagickdraw.setfont.php2024-06-13 02:01 9.1K 
[   ]migration71.other-changes.php2024-06-13 02:01 9.1K 
[   ]function.iconv.php2024-06-13 02:01 9.1K 
[   ]phar.addfile.php2024-06-13 02:01 9.1K 
[   ]function.sqlsrv-next-result.php2024-06-13 02:01 9.1K 
[   ]function.eio-mkdir.php2024-06-13 02:01 9.1K 
[   ]function.pg-lo-open.php2024-06-13 02:01 9.1K 
[   ]function.pg-set-error-verbosity.php2024-06-13 02:01 9.1K 
[   ]function.array-intersect-uassoc.php2024-06-13 02:01 9.1K 
[   ]solrclient.getbyids.php2024-06-13 02:01 9.1K 
[   ]function.mb-strwidth.php2024-06-13 02:01 9.1K 
[   ]function.imagecolortransparent.php2024-06-13 02:01 9.1K 
[   ]domimplementation.hasfeature.php2024-06-13 02:01 9.1K 
[   ]function.strnatcmp.php2024-06-13 02:01 9.1K 
[   ]features.persistent-connections.php2024-06-13 02:01 9.1K 
[   ]datetimeimmutable.setdate.php2024-06-13 02:01 9.1K 
[   ]class.mongodb-driver-exception-serverexception.php2024-06-13 02:01 9.1K 
[   ]function.imagerotate.php2024-06-13 02:01 9.1K 
[   ]memcached.set.php2024-06-13 02:01 9.1K 
[   ]class.mongodb-driver-exception-connectionexception.php2024-06-13 02:01 9.1K 
[   ]class.mongodb-bson-objectid.php2024-06-13 02:01 9.1K 
[   ]class.gearmanjob.php2024-06-13 02:01 9.0K 
[   ]function.strstr.php2024-06-13 02:01 9.0K 
[   ]function.ftp-mlsd.php2024-06-13 02:01 9.0K 
[   ]class.dateinvalidoperationexception.php2024-06-13 02:01 9.0K 
[   ]features.commandline.interactive.php2024-06-13 02:01 9.0K 
[   ]function.snmp3-getnext.php2024-06-13 02:01 9.0K 
[   ]function.session-cache-limiter.php2024-06-13 02:01 9.0K 
[   ]radius.constants.packets.php2024-06-13 02:01 9.0K 
[   ]pharfileinfo.decompress.php2024-06-13 02:01 9.0K 
[   ]pdo.exec.php2024-06-13 02:01 9.0K 
[   ]mongodb.security.script_injection.php2024-06-13 02:01 9.0K 
[   ]function.xml-set-object.php2024-06-13 02:01 9.0K 
[   ]xmlwriter.writeattribute.php2024-06-13 02:01 9.0K 
[   ]function.ftp-put.php2024-06-13 02:01 9.0K 
[   ]function.chr.php2024-06-13 02:01 9.0K 
[   ]function.cubrid-lock-read.php2024-06-13 02:01 9.0K 
[   ]function.oci-fetch-assoc.php2024-06-13 02:01 9.0K 
[   ]function.krsort.php2024-06-13 02:01 9.0K 
[   ]snmp.getnext.php2024-06-13 02:01 9.0K 
[   ]class.commonmark-node-customblock.php2024-06-13 02:01 9.0K 
[   ]mysqli.error.php2024-06-13 02:01 9.0K 
[   ]function.odbc-foreignkeys.php2024-06-13 02:01 9.0K 
[   ]class.mongodb-driver-exception-encryptionexception.php2024-06-13 02:01 9.0K 
[   ]class.mongodb-driver-exception-authenticationexception.php2024-06-13 02:01 9.0K 
[   ]memcached.decrement.php2024-06-13 02:01 9.0K 
[   ]function.pg-field-name.php2024-06-13 02:01 9.0K 
[   ]ziparchive.setcompressionname.php2024-06-13 02:01 9.0K 
[   ]function.gettype.php2024-06-13 02:01 9.0K 
[   ]mongodb-driver-session.starttransaction.php2024-06-13 02:01 9.0K 
[   ]intlcalendar.geterrorcode.php2024-06-13 02:01 9.0K 
[   ]book.ps.php2024-06-13 02:01 9.0K 
[   ]imagick.adaptiveresizeimage.php2024-06-13 02:01 9.0K 
[   ]class.commonmark-node-custominline.php2024-06-13 02:01 9.0K 
[   ]migration73.deprecated.php2024-06-13 02:01 9.0K 
[   ]class.solrparams.php2024-06-13 02:01 9.0K 
[   ]mongodb-driver-writeresult.getmodifiedcount.php2024-06-13 02:01 9.0K 
[   ]function.svn-log.php2024-06-13 02:01 9.0K 
[   ]class.v8js.php2024-06-13 02:01 9.0K 
[   ]class.datemalformedstringexception.php2024-06-13 02:01 9.0K 
[   ]function.session-destroy.php2024-06-13 02:01 9.0K 
[   ]function.imap-reopen.php2024-06-13 02:01 9.0K 
[   ]function.odbc-connect.php2024-06-13 02:01 9.0K 
[   ]configuration.changes.php2024-06-13 02:01 9.0K 
[   ]imagickdraw.setfontweight.php2024-06-13 02:01 9.0K 
[   ]yaf-controller-abstract.forward.php2024-06-13 02:01 9.0K 
[   ]function.db2-column-privileges.php2024-06-13 02:01 9.0K 
[   ]function.array-intersect-assoc.php2024-06-13 02:01 9.0K 
[   ]mongodb-driver-server.executequery.php2024-06-13 02:01 9.0K 
[   ]zlib.examples.php2024-06-13 02:01 9.0K 
[   ]language.generators.comparison.php2024-06-13 02:01 9.0K 
[   ]language.oop5.constants.php2024-06-13 02:01 9.0K 
[   ]mysqli.errno.php2024-06-13 02:01 9.0K 
[   ]fdf.constants.php2024-06-13 02:01 9.0K 
[   ]quickhashintstringhash.loadfromfile.php2024-06-13 02:01 9.0K 
[   ]function.xml-set-element-handler.php2024-06-13 02:01 8.9K 
[   ]class.ui-controls-tab.php2024-06-13 02:01 8.9K 
[   ]intlchar.hasbinaryproperty.php2024-06-13 02:01 8.9K 
[   ]intlchar.getpropertyname.php2024-06-13 02:01 8.9K 
[   ]book.random.php2024-06-13 02:01 8.9K 
[   ]resourcebundle.create.php2024-06-13 02:01 8.9K 
[   ]function.yaz-connect.php2024-06-13 02:01 8.9K 
[   ]function.mysql-list-fields.php2024-06-13 02:01 8.9K 
[   ]intlgregoriancalendar.createfromdatetime.php2024-06-13 02:01 8.9K 
[   ]set.mysqlinfo.php2024-06-13 02:01 8.9K 
[   ]intlchar.enumcharnames.php2024-06-13 02:01 8.9K 
[   ]intro.pthreads.php2024-06-13 02:01 8.9K 
[   ]function.exif-thumbnail.php2024-06-13 02:01 8.9K 
[   ]function.ftp-ssl-connect.php2024-06-13 02:01 8.9K 
[   ]ibm-db2.constants.php2024-06-13 02:01 8.9K 
[   ]function.imagecreatefromgd2part.php2024-06-13 02:01 8.9K 
[   ]function.openssl-csr-get-public-key.php2024-06-13 02:01 8.9K 
[   ]function.oci-fetch-row.php2024-06-13 02:01 8.9K 
[   ]intlcalendar.getminimaldaysinfirstweek.php2024-06-13 02:01 8.9K 
[   ]class.dateerror.php2024-06-13 02:01 8.9K 
[   ]class.daterangeerror.php2024-06-13 02:01 8.9K 
[   ]function.php-uname.php2024-06-13 02:01 8.9K 
[   ]function.image-type-to-mime-type.php2024-06-13 02:01 8.9K 
[   ]function.fann-create-train-from-callback.php2024-06-13 02:01 8.9K 
[   ]function.mb-detect-order.php2024-06-13 02:01 8.9K 
[   ]wrappers.http.php2024-06-13 02:01 8.9K 
[   ]intlcalendar.isweekend.php2024-06-13 02:01 8.9K 
[   ]function.cubrid-fetch-assoc.php2024-06-13 02:01 8.9K 
[   ]class.mysql-xdevapi-collectionfind.php2024-06-13 02:01 8.9K 
[   ]function.stream-get-contents.php2024-06-13 02:01 8.9K 
[   ]xmlwriter.writecdata.php2024-06-13 02:01 8.9K 
[   ]imagickdraw.circle.php2024-06-13 02:01 8.9K 
[   ]mysqli.error-list.php2024-06-13 02:01 8.9K 
[   ]reflectionproperty.getvalue.php2024-06-13 02:01 8.9K 
[   ]function.pg-set-client-encoding.php2024-06-13 02:01 8.9K 
[   ]pdostatement.fetchcolumn.php2024-06-13 02:01 8.9K 
[   ]language.namespaces.definitionmultiple.php2024-06-13 02:01 8.9K 
[   ]class.snmpexception.php2024-06-13 02:01 8.9K 
[   ]function.db2-foreign-keys.php2024-06-13 02:01 8.9K 
[   ]function.dbase-get-record-with-names.php2024-06-13 02:01 8.9K 
[   ]pdo.pgsqllobopen.php2024-06-13 02:01 8.9K 
[   ]function.pg-field-table.php2024-06-13 02:01 8.9K 
[   ]function.imap-sort.php2024-06-13 02:01 8.9K 
[   ]language.operators.array.php2024-06-13 02:01 8.8K 
[   ]pdo.getattribute.php2024-06-13 02:01 8.8K 
[   ]function.odbc-next-result.php2024-06-13 02:01 8.8K 
[   ]function.db2-fetch-object.php2024-06-13 02:01 8.8K 
[   ]opcache.preloading.php2024-06-13 02:01 8.8K 
[   ]language.oop5.cloning.php2024-06-13 02:01 8.8K 
[   ]mysql-xdevapi-collectionmodify.arrayinsert.php2024-06-13 02:01 8.8K 
[   ]imagickdraw.setfontstyle.php2024-06-13 02:01 8.8K 
[   ]mysqli.sqlstate.php2024-06-13 02:01 8.8K 
[   ]function.getenv.php2024-06-13 02:01 8.8K 
[   ]class.solrmodifiableparams.php2024-06-13 02:01 8.8K 
[   ]install.unix.nginx.php2024-06-13 02:01 8.8K 
[   ]function.mysql-list-dbs.php2024-06-13 02:01 8.8K 
[   ]function.cubrid-fetch-row.php2024-06-13 02:01 8.8K 
[   ]class.evfork.php2024-06-13 02:01 8.8K 
[   ]function.grapheme-extract.php2024-06-13 02:01 8.8K 
[   ]class.solrmissingmandatoryparameterexception.php2024-06-13 02:01 8.8K 
[   ]xsltprocessor.setparameter.php2024-06-13 02:01 8.8K 
[   ]function.str-split.php2024-06-13 02:01 8.8K 
[   ]function.ldap-get-values.php2024-06-13 02:01 8.8K 
[   ]function.odbc-columnprivileges.php2024-06-13 02:01 8.8K 
[   ]imagickdraw.setstrokeantialias.php2024-06-13 02:01 8.8K 
[   ]function.imagecolorset.php2024-06-13 02:01 8.8K 
[   ]imagickdraw.setvectorgraphics.php2024-06-13 02:01 8.8K 
[   ]imagickdraw.polyline.php2024-06-13 02:01 8.8K 
[   ]imagickdraw.polygon.php2024-06-13 02:01 8.8K 
[   ]function.inotify-init.php2024-06-13 02:01 8.8K 
[   ]function.mt-srand.php2024-06-13 02:01 8.8K 
[   ]function.pg-put-line.php2024-06-13 02:01 8.8K 
[   ]mysqli-stmt.attr-set.php2024-06-13 02:01 8.8K 
[   ]function.decbin.php2024-06-13 02:01 8.8K 
[   ]recursivedirectoryiterator.construct.php2024-06-13 02:01 8.8K 
[   ]function.ctype-digit.php2024-06-13 02:01 8.8K 
[   ]class.parseerror.php2024-06-13 02:01 8.8K 
[   ]function.pg-result-status.php2024-06-13 02:01 8.8K 
[   ]tutorial.firstpage.php2024-06-13 02:01 8.8K 
[   ]function.radius-put-attr.php2024-06-13 02:01 8.8K 
[   ]function.pg-field-is-null.php2024-06-13 02:01 8.8K 
[   ]migration56.incompatible.php2024-06-13 02:01 8.8K 
[   ]intlcalendar.setfirstdayofweek.php2024-06-13 02:01 8.8K 
[   ]function.xdiff-file-patch.php2024-06-13 02:01 8.8K 
[   ]soapclient.setsoapheaders.php2024-06-13 02:01 8.8K 
[   ]ds-map.reduce.php2024-06-13 02:01 8.8K 
[   ]class.dateobjecterror.php2024-06-13 02:01 8.8K 
[   ]domdocument.importnode.php2024-06-13 02:01 8.7K 
[   ]function.oci-set-prefetch-lob.php2024-06-13 02:01 8.7K 
[   ]dateperiod.getrecurrences.php2024-06-13 02:01 8.7K 
[   ]regexp.reference.character-classes.php2024-06-13 02:01 8.7K 
[   ]function.ssh2-publickey-list.php2024-06-13 02:01 8.7K 
[   ]ziparchive.replacefile.php2024-06-13 02:01 8.7K 
[   ]function.get-browser.php2024-06-13 02:01 8.7K 
[   ]intldateformatter.gettimezoneid.php2024-06-13 02:01 8.7K 
[   ]features.gc.collecting-cycles.php2024-06-13 02:01 8.7K 
[   ]phardata.addfile.php2024-06-13 02:01 8.7K 
[   ]function.sodium-crypto-secretbox-open.php2024-06-13 02:01 8.7K 
[   ]yaf-route-map.construct.php2024-06-13 02:01 8.7K 
[   ]function.db2-tables.php2024-06-13 02:01 8.7K 
[   ]class.jsonexception.php2024-06-13 02:01 8.7K 
[   ]function.sodium-crypto-secretbox.php2024-06-13 02:01 8.7K 
[   ]function.pg-get-result.php2024-06-13 02:01 8.7K 
[   ]xmlwriter.setindent.php2024-06-13 02:01 8.7K 
[   ]book.quickhash.php2024-06-13 02:01 8.7K 
[   ]memcached.getdelayed.php2024-06-13 02:01 8.7K 
[   ]function.snmp3-get.php2024-06-13 02:01 8.7K 
[   ]function.pg-lo-create.php2024-06-13 02:01 8.7K 
[   ]simplexmlelement.registerxpathnamespace.php2024-06-13 02:01 8.7K 
[   ]class.ui-draw-text-font-weight.php2024-06-13 02:01 8.7K 
[   ]function.stream-context-get-default.php2024-06-13 02:01 8.7K 
[   ]imagickdraw.settextantialias.php2024-06-13 02:01 8.7K 
[   ]class.gearmantask.php2024-06-13 02:01 8.7K 
[   ]intlcalendar.get.php2024-06-13 02:01 8.7K 
[   ]function.pg-parameter-status.php2024-06-13 02:01 8.7K 
[   ]function.realpath.php2024-06-13 02:01 8.7K 
[   ]function.sqlsrv-field-metadata.php2024-06-13 02:01 8.7K 
[   ]function.imap-setflag-full.php2024-06-13 02:01 8.7K 
[   ]rarentry.getstream.php2024-06-13 02:01 8.7K 
[   ]function.imap-list.php2024-06-13 02:01 8.7K 
[   ]mongodb-driver-writeresult.getupsertedids.php2024-06-13 02:01 8.7K 
[   ]intlcalendar.add.php2024-06-13 02:01 8.7K 
[   ]function.time-nanosleep.php2024-06-13 02:01 8.7K 
[   ]mongodb-driver-writeresult.getmatchedcount.php2024-06-13 02:01 8.7K 
[   ]language.namespaces.nsconstants.php2024-06-13 02:01 8.7K 
[   ]recursiveiteratoriterator.construct.php2024-06-13 02:01 8.7K 
[   ]memcache.get.php2024-06-13 02:01 8.7K 
[   ]function.forward-static-call.php2024-06-13 02:01 8.7K 
[   ]zmqsocket.recv.php2024-06-13 02:01 8.7K 
[   ]function.db2-next-result.php2024-06-13 02:01 8.7K 
[   ]imagickdraw.setclipunits.php2024-06-13 02:01 8.7K 
[   ]class.datemalformedintervalstringexception.php2024-06-13 02:01 8.7K 
[   ]function.number-format.php2024-06-13 02:01 8.7K 
[   ]intlcalendar.indaylighttime.php2024-06-13 02:01 8.7K 
[   ]mysql-xdevapi-collectionmodify.limit.php2024-06-13 02:01 8.6K 
[   ]class.threaded.php2024-06-13 02:01 8.6K 
[   ]function.openssl-csr-export-to-file.php2024-06-13 02:01 8.6K 
[   ]function.win32-query-service-status.php2024-06-13 02:01 8.6K 
[   ]class.arithmeticerror.php2024-06-13 02:01 8.6K 
[   ]class.datemalformedperiodstringexception.php2024-06-13 02:01 8.6K 
[   ]function.popen.php2024-06-13 02:01 8.6K 
[   ]function.apcu-cas.php2024-06-13 02:01 8.6K 
[   ]phar.extractto.php2024-06-13 02:01 8.6K 
[   ]pdostatement.closecursor.php2024-06-13 02:01 8.6K 
[   ]intlcalendar.getfirstdayofweek.php2024-06-13 02:01 8.6K 
[   ]migration71.constants.php2024-06-13 02:01 8.6K 
[   ]language.types.intro.php2024-06-13 02:01 8.6K 
[   ]language.oop5.object-comparison.php2024-06-13 02:01 8.6K 
[   ]intlcalendar.getactualmaximum.php2024-06-13 02:01 8.6K 
[   ]function.pg-last-notice.php2024-06-13 02:01 8.6K 
[   ]book.parle.php2024-06-13 02:01 8.6K 
[   ]function.iterator-count.php2024-06-13 02:01 8.6K 
[   ]phardata.extractto.php2024-06-13 02:01 8.6K 
[   ]class.mongodb-bson-javascript.php2024-06-13 02:01 8.6K 
[   ]rarentry.gethostos.php2024-06-13 02:01 8.6K 
[   ]mongodb.connection-handling.php2024-06-13 02:01 8.6K 
[   ]function.openssl-pkcs7-verify.php2024-06-13 02:01 8.6K 
[   ]class.phptoken.php2024-06-13 02:01 8.6K 
[   ]book.cmark.php2024-06-13 02:01 8.6K 
[   ]function.openssl-csr-export.php2024-06-13 02:01 8.6K 
[   ]function.socket-getpeername.php2024-06-13 02:01 8.6K 
[   ]solrclient.setresponsewriter.php2024-06-13 02:01 8.6K 
[   ]function.mysql-field-flags.php2024-06-13 02:01 8.6K 
[   ]mysql-xdevapi-docresult.getwarnings.php2024-06-13 02:01 8.6K 
[   ]function.preg-quote.php2024-06-13 02:01 8.6K 
[   ]intlcalendar.settime.php2024-06-13 02:01 8.6K 
[   ]function.sodium-crypto-pwhash-str.php2024-06-13 02:01 8.6K 
[   ]function.gc-status.php2024-06-13 02:01 8.6K 
[   ]odbc.configuration.php2024-06-13 02:01 8.6K 
[   ]function.posix-getrlimit.php2024-06-13 02:01 8.6K 
[   ]function.mysql-create-db.php2024-06-13 02:01 8.6K 
[   ]function.mysql-pconnect.php2024-06-13 02:01 8.6K 
[   ]class.closedgeneratorexception.php2024-06-13 02:01 8.6K 
[   ]language.oop5.paamayim-nekudotayim.php2024-06-13 02:01 8.6K 
[   ]mysql-xdevapi-collection.addorreplaceone.php2024-06-13 02:01 8.6K 
[   ]function.oci-result.php2024-06-13 02:01 8.6K 
[   ]class.domxpath.php2024-06-13 02:01 8.6K 
[   ]seaslog.warning.php2024-06-13 02:01 8.6K 
[   ]mysql-xdevapi-collection.remove.php2024-06-13 02:01 8.6K 
[   ]function.strrchr.php2024-06-13 02:01 8.6K 
[   ]function.cubrid-lob2-export.php2024-06-13 02:01 8.6K 
[   ]ziparchive.addfromstring.php2024-06-13 02:01 8.6K 
[   ]function.yaz-search.php2024-06-13 02:01 8.6K 
[   ]class.dateinvalidtimezoneexception.php2024-06-13 02:01 8.6K 
[   ]snmp.get.php2024-06-13 02:01 8.6K 
[   ]imagickpixeliterator.resetiterator.php2024-06-13 02:01 8.5K 
[   ]function.curl-multi-init.php2024-06-13 02:01 8.5K 
[   ]seaslog.critical.php2024-06-13 02:01 8.5K 
[   ]pdo.pgsqllobcreate.php2024-06-13 02:01 8.5K 
[   ]imagick.setimageclipmask.php2024-06-13 02:01 8.5K 
[   ]function.cubrid-version.php2024-06-13 02:01 8.5K 
[   ]function.move-uploaded-file.php2024-06-13 02:01 8.5K 
[   ]class.mongodb-driver-writeresult.php2024-06-13 02:01 8.5K 
[   ]class.unexpectedvalueexception.php2024-06-13 02:01 8.5K 
[   ]function.oci-field-precision.php2024-06-13 02:01 8.5K 
[   ]function.cubrid-col-size.php2024-06-13 02:01 8.5K 
[   ]intldateformatter.gettimezone.php2024-06-13 02:01 8.5K 
[   ]function.mysql-insert-id.php2024-06-13 02:01 8.5K 
[   ]function.property-exists.php2024-06-13 02:01 8.5K 
[   ]function.oci-set-module-name.php2024-06-13 02:01 8.5K 
[   ]function.json-validate.php2024-06-13 02:01 8.5K 
[   ]ref.ldap.php2024-06-13 02:01 8.5K 
[   ]domnode.appendchild.php2024-06-13 02:01 8.5K 
[   ]seaslog.alert.php2024-06-13 02:01 8.5K 
[   ]class.rangeexception.php2024-06-13 02:01 8.5K 
[   ]function.filter-input.php2024-06-13 02:01 8.5K 
[   ]seaslog.notice.php2024-06-13 02:01 8.5K 
[   ]function.oci-field-scale.php2024-06-13 02:01 8.5K 
[   ]class.argumentcounterror.php2024-06-13 02:01 8.5K 
[   ]class.mysql-xdevapi-tableselect.php2024-06-13 02:01 8.5K 
[   ]pharfileinfo.setmetadata.php2024-06-13 02:01 8.5K 
[   ]imagick.annotateimage.php2024-06-13 02:01 8.5K 
[   ]class.attribute.php2024-06-13 02:01 8.5K 
[   ]imagickpixel.getcolorvalue.php2024-06-13 02:01 8.5K 
[   ]function.mb-regex-set-options.php2024-06-13 02:01 8.5K 
[   ]function.dio-open.php2024-06-13 02:01 8.5K 
[   ]zmqsocket.construct.php2024-06-13 02:01 8.5K 
[   ]seaslog.emergency.php2024-06-13 02:01 8.5K 
[   ]class.mongodb-driver-monitoring-commandfailedevent.php2024-06-13 02:01 8.5K 
[   ]function.array-search.php2024-06-13 02:01 8.5K 
[   ]refs.fileprocess.process.php2024-06-13 02:01 8.5K 
[   ]seaslog.error.php2024-06-13 02:01 8.5K 
[   ]example.xmlwriter-simple.php2024-06-13 02:01 8.5K 
[   ]function.xml-set-unparsed-entity-decl-handler.php2024-06-13 02:01 8.5K 
[   ]phardata.compress.php2024-06-13 02:01 8.5K 
[   ]mysqli-result.field-count.php2024-06-13 02:01 8.5K 
[   ]function.ftp-alloc.php2024-06-13 02:01 8.5K 
[   ]book.ibm-db2.php2024-06-13 02:01 8.5K 
[   ]seaslog.debug.php2024-06-13 02:01 8.5K 
[   ]phar.startbuffering.php2024-06-13 02:01 8.5K 
[   ]seaslog.info.php2024-06-13 02:01 8.5K 
[   ]language.enumerations.basics.php2024-06-13 02:01 8.5K 
[   ]multipleiterator.construct.php2024-06-13 02:01 8.4K 
[   ]class.intlexception.php2024-06-13 02:01 8.4K 
[   ]function.array-keys.php2024-06-13 02:01 8.4K 
[   ]function.imagecolorexact.php2024-06-13 02:01 8.4K 
[   ]function.fgets.php2024-06-13 02:01 8.4K 
[   ]install.windows.commandline.php2024-06-13 02:01 8.4K 
[   ]class.unhandledmatcherror.php2024-06-13 02:01 8.4K 
[   ]class.badmethodcallexception.php2024-06-13 02:01 8.4K 
[   ]mysql-xdevapi-docresult.getwarningscount.php2024-06-13 02:01 8.4K 
[   ]function.uniqid.php2024-06-13 02:01 8.4K 
[   ]function.cubrid-lob2-import.php2024-06-13 02:01 8.4K 
[   ]function.imagefilledrectangle.php2024-06-13 02:01 8.4K 
[   ]imagickdraw.setstrokelinecap.php2024-06-13 02:01 8.4K 
[   ]function.str-pad.php2024-06-13 02:01 8.4K 
[   ]book.pdo.php2024-06-13 02:01 8.4K 
[   ]intldateformatter.geterrorcode.php2024-06-13 02:01 8.4K 
[   ]function.cubrid-col-get.php2024-06-13 02:01 8.4K 
[   ]simplexmlelement.getdocnamespaces.php2024-06-13 02:01 8.4K 
[   ]phar.constants.php2024-06-13 02:01 8.4K 
[   ]mysqlinfo.concepts.charset.php2024-06-13 02:01 8.4K 
[   ]class.badfunctioncallexception.php2024-06-13 02:01 8.4K 
[   ]class.valueerror.php2024-06-13 02:01 8.4K 
[   ]class.random-randomexception.php2024-06-13 02:01 8.4K 
[   ]function.oci-set-action.php2024-06-13 02:01 8.4K 
[   ]parallel-runtime.run.php2024-06-13 02:01 8.4K 
[   ]image.examples.merged-watermark.php2024-06-13 02:01 8.4K 
[   ]function.xml-set-external-entity-ref-handler.php2024-06-13 02:01 8.4K 
[   ]function.db2-table-privileges.php2024-06-13 02:01 8.4K 
[   ]imagickdraw.rectangle.php2024-06-13 02:01 8.4K 
[   ]class.ui-draw-color.php2024-06-13 02:01 8.4K 
[   ]intldateformatter.geterrormessage.php2024-06-13 02:01 8.4K 
[   ]function.wincache-lock.php2024-06-13 02:01 8.4K 
[   ]function.gnupg-verify.php2024-06-13 02:01 8.4K 
[   ]function.mb-str-pad.php2024-06-13 02:01 8.4K 
[   ]function.win32-get-last-control-message.php2024-06-13 02:01 8.4K 
[   ]class.outofrangeexception.php2024-06-13 02:01 8.4K 
[   ]class.outofboundsexception.php2024-06-13 02:01 8.4K 
[   ]class.oauthexception.php2024-06-13 02:01 8.4K 
[   ]function.mysql-ping.php2024-06-13 02:01 8.4K 
[   ]function.imagesettile.php2024-06-13 02:01 8.4K 
[   ]function.cubrid-column-names.php2024-06-13 02:01 8.4K 
[   ]class.underflowexception.php2024-06-13 02:01 8.4K 
[   ]intlchar.digit.php2024-06-13 02:01 8.4K 
[   ]class.random-brokenrandomengineerror.php2024-06-13 02:01 8.4K 
[   ]spl.iterators.php2024-06-13 02:01 8.4K 
[   ]function.sqlsrv-send-stream-data.php2024-06-13 02:01 8.4K 
[   ]function.xmlrpc-encode-request.php2024-06-13 02:01 8.4K 
[   ]timezones.others.php2024-06-13 02:01 8.4K 
[   ]class.invalidargumentexception.php2024-06-13 02:01 8.4K 
[   ]function.cubrid-column-types.php2024-06-13 02:01 8.4K 
[   ]class.worker.php2024-06-13 02:01 8.4K 
[   ]intlcalendar.isequivalentto.php2024-06-13 02:01 8.4K 
[   ]function.pg-lo-write.php2024-06-13 02:01 8.4K 
[   ]class.eventexception.php2024-06-13 02:01 8.4K 
[   ]snmp.constants.php2024-06-13 02:01 8.4K 
[   ]function.imagesetthickness.php2024-06-13 02:01 8.3K 
[   ]function.imagecolormatch.php2024-06-13 02:01 8.3K 
[   ]class.domainexception.php2024-06-13 02:01 8.3K 
[   ]sqlite3.createfunction.php2024-06-13 02:01 8.3K 
[   ]mysqli.character-set-name.php2024-06-13 02:01 8.3K 
[   ]function.ssh2-publickey-add.php2024-06-13 02:01 8.3K 
[   ]function.iconv-substr.php2024-06-13 02:01 8.3K 
[   ]imagickdraw.setstrokecolor.php2024-06-13 02:01 8.3K 
[   ]function.metaphone.php2024-06-13 02:01 8.3K 
[   ]class.logicexception.php2024-06-13 02:01 8.3K 
[   ]imagickdraw.translate.php2024-06-13 02:01 8.3K 
[   ]function.apcu-add.php2024-06-13 02:01 8.3K 
[   ]xmlwriter.startattribute.php2024-06-13 02:01 8.3K 
[   ]memcached.increment.php2024-06-13 02:01 8.3K 
[   ]fann.examples-1.php2024-06-13 02:01 8.3K 
[   ]migration81.new-functions.php2024-06-13 02:01 8.3K 
[   ]function.oci-set-client-info.php2024-06-13 02:01 8.3K 
[   ]class.assertionerror.php2024-06-13 02:01 8.3K 
[   ]function.headers-sent.php2024-06-13 02:01 8.3K 
[   ]yaf-route-supervar.assemble.php2024-06-13 02:01 8.3K 
[   ]yaf-router.addroute.php2024-06-13 02:01 8.3K 
[   ]function.pg-copy-from.php2024-06-13 02:01 8.3K 
[   ]ref.mysql.php2024-06-13 02:01 8.3K 
[   ]function.hash-hmac-file.php2024-06-13 02:01 8.3K 
[   ]yaf-application.construct.php2024-06-13 02:01 8.3K 
[   ]imagickdraw.setstrokewidth.php2024-06-13 02:01 8.3K 
[   ]function.apcu-entry.php2024-06-13 02:01 8.3K 
[   ]class.yaf-exception.php2024-06-13 02:01 8.3K 
[   ]class.overflowexception.php2024-06-13 02:01 8.3K 
[   ]pdostatement.nextrowset.php2024-06-13 02:01 8.3K 
[   ]function.ldap-get-attributes.php2024-06-13 02:01 8.3K 
[   ]function.is-soap-fault.php2024-06-13 02:01 8.3K 
[   ]stomp.construct.php2024-06-13 02:01 8.3K 
[   ]imagickdraw.push.php2024-06-13 02:01 8.3K 
[   ]function.mysqli-get-client-stats.php2024-06-13 02:01 8.3K 
[   ]pdo.commit.php2024-06-13 02:01 8.3K 
[   ]imagickpixel.setcolorvaluequantum.php2024-06-13 02:01 8.3K 
[   ]function.cubrid-get-server-info.php2024-06-13 02:01 8.3K 
[   ]class.random-randomerror.php2024-06-13 02:01 8.3K 
[   ]eventbuffer.search.php2024-06-13 02:01 8.3K 
[   ]function.str-contains.php2024-06-13 02:01 8.3K 
[   ]class.runtimeexception.php2024-06-13 02:01 8.3K 
[   ]function.openssl-spki-export.php2024-06-13 02:01 8.3K 
[   ]function.mysql-errno.php2024-06-13 02:01 8.3K 
[   ]class.lengthexception.php2024-06-13 02:01 8.3K 
[   ]function.finfo-buffer.php2024-06-13 02:01 8.3K 
[   ]class.commonmark-node-thematicbreak.php2024-06-13 02:01 8.3K 
[   ]class.commonmark-node-text-emphasis.php2024-06-13 02:01 8.3K 
[   ]class.divisionbyzeroerror.php2024-06-13 02:01 8.3K 
[   ]random-engine-xoshiro256starstar.construct.php2024-06-13 02:01 8.3K 
[   ]ziparchive.extractto.php2024-06-13 02:01 8.3K 
[   ]function.mysql-error.php2024-06-13 02:01 8.3K 
[   ]class.mongodb-bson-timestamp.php2024-06-13 02:01 8.3K 
[   ]imagickdraw.setstrokealpha.php2024-06-13 02:01 8.3K 
[   ]class.commonmark-node-text-strong.php2024-06-13 02:01 8.3K 
[   ]class.pharexception.php2024-06-13 02:01 8.3K 
[   ]imagickdraw.setclippath.php2024-06-13 02:01 8.3K 
[   ]phardata.decompress.php2024-06-13 02:01 8.3K 
[   ]pdostatement.getcolumnmeta.php2024-06-13 02:01 8.3K 
[   ]class.commonmark-node-paragraph.php2024-06-13 02:01 8.3K 
[   ]intlcalendar.getleastmaximum.php2024-06-13 02:01 8.3K 
[TXT]phar.using.object.php2024-06-13 02:01 8.3K 
[   ]function.imagecreate.php2024-06-13 02:01 8.3K 
[   ]function.eio-statvfs.php2024-06-13 02:01 8.3K 
[   ]function.imagecolorresolvealpha.php2024-06-13 02:01 8.3K 
[   ]class.commonmark-node-blockquote.php2024-06-13 02:01 8.3K 
[   ]class.commonmark-node-softbreak.php2024-06-13 02:01 8.3K 
[   ]function.compact.php2024-06-13 02:01 8.3K 
[   ]xmlwriter.writeelementns.php2024-06-13 02:01 8.3K 
[   ]intlcalendar.islenient.php2024-06-13 02:01 8.3K 
[   ]class.reflectionexception.php2024-06-13 02:01 8.3K 
[   ]class.compileerror.php2024-06-13 02:01 8.3K 
[   ]function.str-starts-with.php2024-06-13 02:01 8.3K 
[   ]function.odbc-tableprivileges.php2024-06-13 02:01 8.3K 
[   ]ds-map.get.php2024-06-13 02:01 8.3K 
[   ]mysql-xdevapi-collectionmodify.bind.php2024-06-13 02:01 8.2K 
[   ]reflectionproperty.hasdefaultvalue.php2024-06-13 02:01 8.2K 
[   ]class.commonmark-node-linebreak.php2024-06-13 02:01 8.2K 
[   ]function.pg-lo-export.php2024-06-13 02:01 8.2K 
[   ]class.sodiumexception.php2024-06-13 02:01 8.2K 
[   ]streamwrapper.stream-metadata.php2024-06-13 02:01 8.2K 
[   ]function.socket-read.php2024-06-13 02:01 8.2K 
[   ]function.pcntl-wait.php2024-06-13 02:01 8.2K 
[   ]function.openssl-cms-sign.php2024-06-13 02:01 8.2K 
[   ]regexp.reference.repetition.php2024-06-13 02:01 8.2K 
[   ]intro-whatcando.php2024-06-13 02:01 8.2K 
[   ]mysql-xdevapi-collectionfind.limit.php2024-06-13 02:01 8.2K 
[   ]ds-map.filter.php2024-06-13 02:01 8.2K 
[   ]class.commonmark-node-item.php2024-06-13 02:01 8.2K 
[   ]imagickdraw.matte.php2024-06-13 02:01 8.2K 
[   ]class.curlfile.php2024-06-13 02:01 8.2K 
[   ]function.pg-result-error.php2024-06-13 02:01 8.2K 
[   ]class.commonmark-node-document.php2024-06-13 02:01 8.2K 
[   ]class.com-exception.php2024-06-13 02:01 8.2K 
[   ]mysqlnd.plugin.php2024-06-13 02:01 8.2K 
[   ]function.str-ends-with.php2024-06-13 02:01 8.2K 
[   ]class.yaf-route-regex.php2024-06-13 02:01 8.2K 
[   ]function.password-needs-rehash.php2024-06-13 02:01 8.2K 
[   ]class.sqlite3exception.php2024-06-13 02:01 8.2K 
[   ]language.types.type-system.php2024-06-13 02:01 8.2K 
[   ]function.iconv-mime-decode.php2024-06-13 02:01 8.2K 
[   ]class.stringable.php2024-06-13 02:01 8.2K 
[   ]random-engine-pcgoneseq128xslrr64.construct.php2024-06-13 02:01 8.2K 
[   ]mongodb-driver-writeresult.getupsertedcount.php2024-06-13 02:01 8.2K 
[   ]pdostatement.setfetchmode.php2024-06-13 02:01 8.2K 
[   ]function.dbase-create.php2024-06-13 02:01 8.2K 
[   ]function.pg-send-query-params.php2024-06-13 02:01 8.2K 
[   ]mysql-xdevapi-collection.modify.php2024-06-13 02:01 8.2K 
[   ]imagickdraw.line.php2024-06-13 02:01 8.2K 
[   ]mysqli.get-charset.php2024-06-13 02:01 8.2K 
[   ]install.unix.php2024-06-13 02:01 8.2K 
[   ]function.touch.php2024-06-13 02:01 8.2K 
[   ]class.ds-priorityqueue.php2024-06-13 02:01 8.2K 
[   ]function.ftp-rawlist.php2024-06-13 02:01 8.2K 
[   ]evtimer.createstopped.php2024-06-13 02:01 8.2K 
[   ]stomp.error.php2024-06-13 02:01 8.2K 
[   ]function.is-scalar.php2024-06-13 02:01 8.2K 
[   ]mail.configuration.php2024-06-13 02:01 8.2K 
[   ]book.info.php2024-06-13 02:01 8.2K 
[   ]function.enchant-dict-quick-check.php2024-06-13 02:01 8.2K 
[   ]function.ps-lineto.php2024-06-13 02:01 8.2K 
[   ]migration81.constants.php2024-06-13 02:01 8.2K 
[   ]mysql-xdevapi-collection.replaceone.php2024-06-13 02:01 8.2K 
[   ]class.componere-patch.php2024-06-13 02:01 8.2K 
[   ]collator.sort.php2024-06-13 02:01 8.2K 
[   ]function.zookeeper-dispatch.php2024-06-13 02:01 8.2K 
[   ]class.simdjsonvalueerror.php2024-06-13 02:01 8.2K 
[   ]class.ui-controls-group.php2024-06-13 02:01 8.2K 
[   ]gearmanclient.jobstatus.php2024-06-13 02:01 8.2K 
[   ]snmp.construct.php2024-06-13 02:01 8.2K 
[   ]function.cubrid-field-len.php2024-06-13 02:01 8.2K 
[   ]class.serializable.php2024-06-13 02:01 8.2K 
[   ]pdostatement.columncount.php2024-06-13 02:01 8.2K 
[   ]mysqli.ssl-set.php2024-06-13 02:01 8.2K 
[   ]language.namespaces.dynamic.php2024-06-13 02:01 8.1K 
[   ]imagick.frameimage.php2024-06-13 02:01 8.1K 
[   ]class.sqlite3stmt.php2024-06-13 02:01 8.1K 
[   ]class.mysqli-driver.php2024-06-13 02:01 8.1K 
[   ]class.rarexception.php2024-06-13 02:01 8.1K 
[   ]function.eio-rmdir.php2024-06-13 02:01 8.1K 
[   ]language.attributes.reflection.php2024-06-13 02:01 8.1K 
[   ]function.xdiff-string-patch.php2024-06-13 02:01 8.1K 
[   ]function.pg-lo-seek.php2024-06-13 02:01 8.1K 
[   ]mysql-xdevapi-collectionmodify.arrayappend.php2024-06-13 02:01 8.1K 
[   ]mongodb-driver-writeresult.getinsertedcount.php2024-06-13 02:01 8.1K 
[   ]imagickdraw.setfontsize.php2024-06-13 02:01 8.1K 
[   ]mysql-xdevapi-collectionfind.sort.php2024-06-13 02:01 8.1K 
[   ]book.session.php2024-06-13 02:01 8.1K 
[   ]mysql-xdevapi-collectionfind.offset.php2024-06-13 02:01 8.1K 
[   ]function.microtime.php2024-06-13 02:01 8.1K 
[   ]faq.databases.php2024-06-13 02:01 8.1K 
[   ]class.ui-draw-text-font-stretch.php2024-06-13 02:01 8.1K 
[   ]function.hash-hmac.php2024-06-13 02:01 8.1K 
[   ]function.apcu-dec.php2024-06-13 02:01 8.1K 
[   ]function.pg-escape-literal.php2024-06-13 02:01 8.1K 
[   ]function.mysql-num-rows.php2024-06-13 02:01 8.1K 
[   ]ref.ibm-db2.php2024-06-13 02:01 8.1K 
[   ]function.phpcredits.php2024-06-13 02:01 8.1K 
[   ]function.imap-getsubscribed.php2024-06-13 02:01 8.1K 
[   ]function.openssl-pkey-derive.php2024-06-13 02:01 8.1K 
[   ]function.addcslashes.php2024-06-13 02:01 8.1K 
[   ]class.ffi-parserexception.php2024-06-13 02:01 8.1K 
[   ]function.imagebmp.php2024-06-13 02:01 8.1K 
[   ]function.apcu-inc.php2024-06-13 02:01 8.1K 
[   ]mongodb-driver-writeresult.isacknowledged.php2024-06-13 02:01 8.1K 
[   ]function.grapheme-stripos.php2024-06-13 02:01 8.1K 
[   ]arrayobject.natcasesort.php2024-06-13 02:01 8.1K 
[   ]mysql.installation.php2024-06-13 02:01 8.1K 
[   ]function.session-gc.php2024-06-13 02:01 8.1K 
[   ]function.opendir.php2024-06-13 02:01 8.1K 
[   ]class.recursivefilteriterator.php2024-06-13 02:01 8.1K 
[   ]class.mongodb-driver-monitoring-commandsucceededevent.php2024-06-13 02:01 8.1K 
[   ]openssl.pkcs7.flags.php2024-06-13 02:01 8.1K 
[   ]function.svn-commit.php2024-06-13 02:01 8.1K 
[   ]xmlwriter.writedtd.php2024-06-13 02:01 8.1K 
[   ]function.cubrid-real-escape-string.php2024-06-13 02:01 8.1K 
[   ]function.get-mangled-object-vars.php2024-06-13 02:01 8.1K 
[   ]phar.iscompressed.php2024-06-13 02:01 8.1K 
[   ]features.dtrace.systemtap.php2024-06-13 02:01 8.1K 
[   ]function.oci-set-client-identifier.php2024-06-13 02:01 8.1K 
[   ]zookeeper.create.php2024-06-13 02:01 8.1K 
[   ]control-structures.continue.php2024-06-13 02:01 8.1K 
[   ]mongodb-driver-readpreference.getmaxstalenessseconds.php2024-06-13 02:01 8.1K 
[   ]function.stream-filter-prepend.php2024-06-13 02:01 8.1K 
[   ]class.parallel-channel.php2024-06-13 02:01 8.1K 
[   ]memcache.getextendedstats.php2024-06-13 02:01 8.1K 
[   ]ldap.examples-basic.php2024-06-13 02:01 8.1K 
[   ]evstat.attr.php2024-06-13 02:01 8.1K 
[   ]mysql-xdevapi-collectionfind.bind.php2024-06-13 02:01 8.1K 
[   ]function.cubrid-set-db-parameter.php2024-06-13 02:01 8.1K 
[   ]function.xml-parse.php2024-06-13 02:01 8.1K 
[   ]mysqli.quickstart.metadata.php2024-06-13 02:01 8.1K 
[   ]book.mysql.php2024-06-13 02:01 8.1K 
[   ]mysqli.debug.php2024-06-13 02:01 8.1K 
[   ]class.mongodb-driver-exception-unexpectedvalueexception.php2024-06-13 02:01 8.1K 
[   ]mongodb-bson-utcdatetime.construct.php2024-06-13 02:01 8.1K 
[   ]ziparchive.getexternalattributesindex.php2024-06-13 02:01 8.1K 
[   ]solrclient.construct.php2024-06-13 02:01 8.1K 
[   ]function.ibase-pconnect.php2024-06-13 02:01 8.1K 
[   ]mongodb-driver-writeresult.getdeletedcount.php2024-06-13 02:01 8.1K 
[   ]function.radius-get-vendor-attr.php2024-06-13 02:01 8.0K 
[   ]class.mongodb-bson-regex.php2024-06-13 02:01 8.0K 
[   ]class.ffi-exception.php2024-06-13 02:01 8.0K 
[   ]splobjectstorage.gethash.php2024-06-13 02:01 8.0K 
[   ]function.pspell-config-create.php2024-06-13 02:01 8.0K 
[   ]function.openssl-pkcs7-decrypt.php2024-06-13 02:01 8.0K 
[   ]function.pg-escape-bytea.php2024-06-13 02:01 8.0K 
[   ]function.wordwrap.php2024-06-13 02:01 8.0K 
[   ]class.mongodb-driver-exception-invalidargumentexception.php2024-06-13 02:01 8.0K 
[   ]function.gregoriantojd.php2024-06-13 02:01 8.0K 
[   ]function.cubrid-get-client-info.php2024-06-13 02:01 8.0K 
[   ]ds-map.ksorted.php2024-06-13 02:01 8.0K 
[   ]function.sqlsrv-num-fields.php2024-06-13 02:01 8.0K 
[   ]xmlwriter.writeattributens.php2024-06-13 02:01 8.0K 
[   ]mbstring.supported-encodings.php2024-06-13 02:01 8.0K 
[   ]function.mysql-tablename.php2024-06-13 02:01 8.0K 
[   ]migration71.changed-functions.php2024-06-13 02:01 8.0K 
[   ]pdo.sqlitecreatecollation.php2024-06-13 02:01 8.0K 
[   ]ziparchive.getfromname.php2024-06-13 02:01 8.0K 
[   ]features.remote-files.php2024-06-13 02:01 8.0K 
[   ]zookeeper.addauth.php2024-06-13 02:01 8.0K 
[   ]imagickdraw.skewx.php2024-06-13 02:01 8.0K 
[   ]ds-map.sorted.php2024-06-13 02:01 8.0K 
[   ]intlchar.getintpropertyvalue.php2024-06-13 02:01 8.0K 
[   ]imagickdraw.skewy.php2024-06-13 02:01 8.0K 
[   ]function.get-meta-tags.php2024-06-13 02:01 8.0K 
[   ]function.db2-last-insert-id.php2024-06-13 02:01 8.0K 
[   ]function.ibase-blob-import.php2024-06-13 02:01 8.0K 
[   ]phar.createdefaultstub.php2024-06-13 02:01 8.0K 
[   ]domdocument.createattributens.php2024-06-13 02:01 8.0K 
[   ]closure.bind.php2024-06-13 02:01 8.0K 
[   ]mysql-xdevapi-docresult.fetchall.php2024-06-13 02:01 8.0K 
[   ]function.snmpwalkoid.php2024-06-13 02:01 8.0K 
[   ]simplexmlelement.asxml.php2024-06-13 02:01 8.0K 
[   ]function.openssl-decrypt.php2024-06-13 02:01 8.0K 
[   ]gearmanclient.dostatus.php2024-06-13 02:01 8.0K 
[   ]migration83.deprecated.php2024-06-13 02:01 8.0K 
[   ]function.stream-set-timeout.php2024-06-13 02:01 8.0K 
[   ]function.socket-getsockname.php2024-06-13 02:01 8.0K 
[   ]example.xml-map-tags.php2024-06-13 02:01 8.0K 
[   ]function.imagecreatefromstring.php2024-06-13 02:01 8.0K 
[   ]tidy.getoptdoc.php2024-06-13 02:01 8.0K 
[   ]mongodb-driver-readconcern.isdefault.php2024-06-13 02:01 8.0K 
[   ]function.trigger-error.php2024-06-13 02:01 8.0K 
[   ]function.xattr-set.php2024-06-13 02:01 8.0K 
[   ]function.grapheme-substr.php2024-06-13 02:01 8.0K 
[   ]function.mb-strimwidth.php2024-06-13 02:01 8.0K 
[   ]function.key.php2024-06-13 02:01 8.0K 
[   ]ds-map.ksort.php2024-06-13 02:01 8.0K 
[   ]class.fibererror.php2024-06-13 02:01 8.0K 
[   ]mongodb-driver-readpreference.gettagsets.php2024-06-13 02:01 8.0K 
[   ]imagickdraw.scale.php2024-06-13 02:01 8.0K 
[   ]ds-sequence.reduce.php2024-06-13 02:01 8.0K 
[   ]function.ssh2-shell.php2024-06-13 02:01 8.0K 
[   ]class.ui-draw-pen.php2024-06-13 02:01 8.0K 
[   ]quickhashinthash.loadfromfile.php2024-06-13 02:01 7.9K 
[   ]gender.example.admin.php2024-06-13 02:01 7.9K 
[   ]function.openssl-x509-checkpurpose.php2024-06-13 02:01 7.9K 
[   ]mysql-xdevapi-collectionmodify.replace.php2024-06-13 02:01 7.9K 
[   ]class.mongodb-driver-exception-logicexception.php2024-06-13 02:01 7.9K 
[   ]ref.info.php2024-06-13 02:01 7.9K 
[   ]mysqli-stmt.send-long-data.php2024-06-13 02:01 7.9K 
[   ]function.socket-connect.php2024-06-13 02:01 7.9K 
[   ]function.natcasesort.php2024-06-13 02:01 7.9K 
[   ]functions.internal.php2024-06-13 02:01 7.9K 
[   ]class.mysql-xdevapi-schema.php2024-06-13 02:01 7.9K 
[   ]function.implode.php2024-06-13 02:01 7.9K 
[   ]mysql-xdevapi-tableselect.having.php2024-06-13 02:01 7.9K 
[   ]function.imap-thread.php2024-06-13 02:01 7.9K 
[   ]function.fseek.php2024-06-13 02:01 7.9K 
[   ]intlcalendar.fromdatetime.php2024-06-13 02:01 7.9K 
[   ]book.memcached.php2024-06-13 02:01 7.9K 
[   ]function.radius-put-string.php2024-06-13 02:01 7.9K 
[   ]class.mongodb-bson-utcdatetime.php2024-06-13 02:01 7.9K 
[   ]function.eio-get-event-stream.php2024-06-13 02:01 7.9K 
[   ]book.com.php2024-06-13 02:01 7.9K 
[   ]ds-map.sort.php2024-06-13 02:01 7.9K 
[   ]luasandboxfunction.call.php2024-06-13 02:01 7.9K 
[   ]function.odbc-specialcolumns.php2024-06-13 02:01 7.9K 
[   ]mongodb-driver-cursor.settypemap.php2024-06-13 02:01 7.9K 
[   ]function.openssl-pkcs12-export.php2024-06-13 02:01 7.9K 
[   ]function.ibase-set-event-handler.php2024-06-13 02:01 7.9K 
[   ]function.mysql-drop-db.php2024-06-13 02:01 7.9K 
[   ]intlchar.getpropertyvalueenum.php2024-06-13 02:01 7.9K 
[   ]splobjectstorage.current.php2024-06-13 02:01 7.9K 
[   ]mysql-xdevapi-collectionmodify.set.php2024-06-13 02:01 7.9K 
[   ]rararchive.isbroken.php2024-06-13 02:01 7.9K 
[   ]phar.addfromstring.php2024-06-13 02:01 7.9K 
[   ]function.odbc-primarykeys.php2024-06-13 02:01 7.9K 
[   ]dateperiod.createfromiso8601string.php2024-06-13 02:01 7.9K 
[   ]class.ui-controls-form.php2024-06-13 02:01 7.9K 
[   ]ds-vector.reduce.php2024-06-13 02:01 7.9K 
[   ]function.imageresolution.php2024-06-13 02:01 7.9K 
[   ]domnode.c14n.php2024-06-13 02:01 7.9K 
[   ]class.swoole-async.php2024-06-13 02:01 7.9K 
[   ]function.imap-rfc822-parse-adrlist.php2024-06-13 02:01 7.9K 
[   ]function.openssl-pkcs12-export-to-file.php2024-06-13 02:01 7.9K 
[   ]phar.stopbuffering.php2024-06-13 02:01 7.9K 
[   ]function.db2-procedures.php2024-06-13 02:01 7.9K 
[   ]function.variant-cmp.php2024-06-13 02:01 7.9K 
[   ]function.defined.php2024-06-13 02:01 7.9K 
[   ]function.ps-get-parameter.php2024-06-13 02:01 7.9K 
[   ]imagick.compositeimage.php2024-06-13 02:01 7.8K 
[   ]intlchar.totitle.php2024-06-13 02:01 7.8K 
[   ]function.ssh2-methods-negotiated.php2024-06-13 02:01 7.8K 
[   ]function.curl-unescape.php2024-06-13 02:01 7.8K 
[   ]function.iterator-to-array.php2024-06-13 02:01 7.8K 
[   ]mongodb-bson-binary.construct.php2024-06-13 02:01 7.8K 
[   ]domxpath.evaluate.php2024-06-13 02:01 7.8K 
[   ]mongodb-driver-manager.getservers.php2024-06-13 02:01 7.8K 
[   ]reflectionclass.getproperties.php2024-06-13 02:01 7.8K 
[   ]function.strnatcasecmp.php2024-06-13 02:01 7.8K 
[   ]quickhashinthash.exists.php2024-06-13 02:01 7.8K 
[   ]ds-deque.reduce.php2024-06-13 02:01 7.8K 
[   ]function.rnp-key-get-info.php2024-06-13 02:01 7.8K 
[   ]ds-map.slice.php2024-06-13 02:01 7.8K 
[   ]ziparchive.setencryptionname.php2024-06-13 02:01 7.8K 
[   ]ibase.configuration.php2024-06-13 02:01 7.8K 
[   ]function.idn-to-utf8.php2024-06-13 02:01 7.8K 
[   ]function.get-resources.php2024-06-13 02:01 7.8K 
[   ]domdocumentfragment.replacechildren.php2024-06-13 02:01 7.8K 
[   ]function.system.php2024-06-13 02:01 7.8K 
[   ]function.db2-result.php2024-06-13 02:01 7.8K 
[   ]function.oci-num-rows.php2024-06-13 02:01 7.8K 
[   ]mysql-xdevapi-collectionadd.construct.php2024-06-13 02:01 7.8K 
[   ]imagick.sigmoidalcontrastimage.php2024-06-13 02:01 7.8K 
[   ]mysql-xdevapi-collectionadd.execute.php2024-06-13 02:01 7.8K 
[   ]migration83.new-features.php2024-06-13 02:01 7.8K 
[   ]function.sqlsrv-rows-affected.php2024-06-13 02:01 7.8K 
[   ]function.idn-to-ascii.php2024-06-13 02:01 7.8K 
[   ]imagick.exportimagepixels.php2024-06-13 02:01 7.8K 
[   ]mysqli.rollback.php2024-06-13 02:01 7.8K 
[   ]function.oci-field-type-raw.php2024-06-13 02:01 7.8K 
[   ]class.fiber.php2024-06-13 02:01 7.8K 
[   ]splfileinfo.openfile.php2024-06-13 02:01 7.8K 
[   ]arrayobject.natsort.php2024-06-13 02:01 7.8K 
[   ]function.proc-nice.php2024-06-13 02:01 7.8K 
[   ]domdocument.savehtmlfile.php2024-06-13 02:01 7.8K 
[   ]function.mysql-free-result.php2024-06-13 02:01 7.8K 
[   ]openssl.cms.flags.php2024-06-13 02:01 7.8K 
[   ]zookeeperconfig.add.php2024-06-13 02:01 7.8K 
[   ]function.rnp-op-encrypt.php2024-06-13 02:01 7.8K 
[   ]function.register-shutdown-function.php2024-06-13 02:01 7.8K 
[   ]com.configuration.php2024-06-13 02:01 7.8K 
[   ]function.pg-last-oid.php2024-06-13 02:01 7.8K 
[   ]mongodb-driver-writeexception.getwriteresult.php2024-06-13 02:01 7.8K 
[   ]ds-set.reduce.php2024-06-13 02:01 7.8K 
[   ]evembed.construct.php2024-06-13 02:01 7.8K 
[   ]regexiterator.setmode.php2024-06-13 02:01 7.8K 
[   ]domdocument.loadhtmlfile.php2024-06-13 02:01 7.8K 
[   ]rararchive.issolid.php2024-06-13 02:01 7.8K 
[   ]book.eio.php2024-06-13 02:01 7.8K 
[   ]function.mysql-db-name.php2024-06-13 02:01 7.8K 
[   ]class.luasandboxmemoryerror.php2024-06-13 02:01 7.8K 
[   ]function.grapheme-strpos.php2024-06-13 02:01 7.8K 
[   ]function.sqlsrv-num-rows.php2024-06-13 02:01 7.8K 
[   ]function.radius-put-vendor-attr.php2024-06-13 02:01 7.8K 
[   ]mongodb-driver-writeconcern.isdefault.php2024-06-13 02:01 7.8K 
[   ]eventhttp.bind.php2024-06-13 02:01 7.8K 
[   ]gearmanworker.addfunction.php2024-06-13 02:01 7.8K 
[   ]class.luasandboxtimeouterror.php2024-06-13 02:01 7.8K 
[   ]phardata.buildfromdirectory.php2024-06-13 02:01 7.8K 
[   ]eventbufferevent.getoutput.php2024-06-13 02:01 7.8K 
[   ]function.oci-field-is-null.php2024-06-13 02:01 7.8K 
[   ]eventhttp.setdefaultcallback.php2024-06-13 02:01 7.8K 
[   ]function.pg-escape-identifier.php2024-06-13 02:01 7.8K 
[   ]function.oci-set-db-operation.php2024-06-13 02:01 7.8K 
[   ]datetime.getoffset.php2024-06-13 02:01 7.8K 
[   ]function.deflate-init.php2024-06-13 02:01 7.8K 
[   ]function.session-name.php2024-06-13 02:01 7.7K 
[   ]quickhashintset.exists.php2024-06-13 02:01 7.7K 
[   ]function.socket-listen.php2024-06-13 02:01 7.7K 
[   ]function.get-parent-class.php2024-06-13 02:01 7.7K 
[   ]function.mysql-select-db.php2024-06-13 02:01 7.7K 
[   ]gearmanworker.wait.php2024-06-13 02:01 7.7K 
[   ]language.operators.logical.php2024-06-13 02:01 7.7K 
[   ]function.ignore-user-abort.php2024-06-13 02:01 7.7K 
[   ]class.soapvar.php2024-06-13 02:01 7.7K 
[   ]imagickpixel.getcolor.php2024-06-13 02:01 7.7K 
[   ]ref.datetime.php2024-06-13 02:01 7.7K 
[   ]domcharacterdata.replacewith.php2024-06-13 02:01 7.7K 
[   ]function.gmdate.php2024-06-13 02:01 7.7K 
[   ]appenditerator.key.php2024-06-13 02:01 7.7K 
[   ]class.reflectionzendextension.php2024-06-13 02:01 7.7K 
[   ]function.pspell-store-replacement.php2024-06-13 02:01 7.7K 
[   ]mysql-xdevapi-tableselect.groupby.php2024-06-13 02:01 7.7K 
[   ]mysql-xdevapi-collection.removeone.php2024-06-13 02:01 7.7K 
[   ]function.xml-parser-set-option.php2024-06-13 02:01 7.7K 
[   ]function.grapheme-stristr.php2024-06-13 02:01 7.7K 
[   ]domelement.replacewith.php2024-06-13 02:01 7.7K 
[   ]function.pg-escape-string.php2024-06-13 02:01 7.7K 
[   ]function.wincache-refresh-if-changed.php2024-06-13 02:01 7.7K 
[   ]function.imagecrop.php2024-06-13 02:01 7.7K 
[   ]class.appenditerator.php2024-06-13 02:01 7.7K 
[   ]function.mysql-fetch-row.php2024-06-13 02:01 7.7K 
[   ]intlchar.tolower.php2024-06-13 02:01 7.7K 
[   ]mysqli.commit.php2024-06-13 02:01 7.7K 
[   ]function.array-walk-recursive.php2024-06-13 02:01 7.7K 
[   ]function.cubrid-lob-export.php2024-06-13 02:01 7.7K 
[   ]function.array-chunk.php2024-06-13 02:01 7.7K 
[   ]pharfileinfo.getmetadata.php2024-06-13 02:01 7.7K 
[   ]function.openssl-spki-verify.php2024-06-13 02:01 7.7K 
[   ]numberformatter.getlocale.php2024-06-13 02:01 7.7K 
[   ]imagickdraw.setfillopacity.php2024-06-13 02:01 7.7K 
[   ]function.imagesavealpha.php2024-06-13 02:01 7.7K 
[   ]class.ds-queue.php2024-06-13 02:01 7.7K 
[   ]function.ps-setpolydash.php2024-06-13 02:01 7.7K 
[   ]class.parallel-future.php2024-06-13 02:01 7.7K 
[   ]datetime.gettimezone.php2024-06-13 02:01 7.7K 
[   ]class.mongodb-bson-decimal128.php2024-06-13 02:01 7.7K 
[   ]streamwrapper.stream-open.php2024-06-13 02:01 7.7K 
[   ]function.pg-get-notify.php2024-06-13 02:01 7.7K 
[   ]function.imagecolorresolve.php2024-06-13 02:01 7.7K 
[   ]class.eventconfig.php2024-06-13 02:01 7.7K 
[   ]yaf-dispatcher.throwexception.php2024-06-13 02:01 7.7K 
[   ]function.passthru.php2024-06-13 02:01 7.7K 
[   ]function.wincache-unlock.php2024-06-13 02:01 7.7K 
[   ]oauth.getrequesttoken.php2024-06-13 02:01 7.7K 
[   ]varnish.constants.php2024-06-13 02:01 7.7K 
[   ]function.geoip-record-by-name.php2024-06-13 02:01 7.7K 
[   ]migration82.new-features.php2024-06-13 02:01 7.7K 
[   ]migration71.windows-support.php2024-06-13 02:01 7.7K 
[   ]function.radius-add-server.php2024-06-13 02:01 7.7K 
[   ]domdocument.loadhtml.php2024-06-13 02:01 7.7K 
[   ]zookeeperconfig.remove.php2024-06-13 02:01 7.7K 
[   ]function.cubrid-field-flags.php2024-06-13 02:01 7.7K 
[   ]mysql-xdevapi-collectionfind.fields.php2024-06-13 02:01 7.7K 
[   ]mysql-xdevapi-docresult.fetchone.php2024-06-13 02:01 7.7K 
[   ]migration74.constants.php2024-06-13 02:01 7.7K 
[   ]imagickdraw.settextundercolor.php2024-06-13 02:01 7.7K 
[   ]domcharacterdata.after.php2024-06-13 02:01 7.7K 
[   ]function.feof.php2024-06-13 02:01 7.7K 
[   ]function.escapeshellcmd.php2024-06-13 02:01 7.7K 
[   ]domelement.replacechildren.php2024-06-13 02:01 7.7K 
[   ]function.mysql-list-processes.php2024-06-13 02:01 7.7K 
[   ]class.win32serviceexception.php2024-06-13 02:01 7.7K 
[   ]yaml.examples.php2024-06-13 02:01 7.7K 
[   ]function.sapi-windows-generate-ctrl-event.php2024-06-13 02:01 7.7K 
[   ]class.swoole-websocket-server.php2024-06-13 02:01 7.7K 
[   ]random-randomizer.shufflebytes.php2024-06-13 02:01 7.7K 
[   ]function.xml-set-notation-decl-handler.php2024-06-13 02:01 7.7K 
[   ]ref.oci8.php2024-06-13 02:01 7.6K 
[   ]imagick.tintimage.php2024-06-13 02:01 7.6K 
[   ]gearmanworker.settimeout.php2024-06-13 02:01 7.6K 
[   ]function.stream-context-create.php2024-06-13 02:01 7.6K 
[   ]splfileobject.construct.php2024-06-13 02:01 7.6K 
[   ]imagickdraw.setfillcolor.php2024-06-13 02:01 7.6K 
[   ]function.imagefill.php2024-06-13 02:01 7.6K 
[   ]imagickdraw.setfillalpha.php2024-06-13 02:01 7.6K 
[   ]function.snmp-set-oid-output-format.php2024-06-13 02:01 7.6K 
[   ]function.curl-share-close.php2024-06-13 02:01 7.6K 
[   ]function.oci-new-cursor.php2024-06-13 02:01 7.6K 
[   ]quickhashstringinthash.loadfromstring.php2024-06-13 02:01 7.6K 
[   ]phptoken.tokenize.php2024-06-13 02:01 7.6K 
[   ]class.ui-exception-invalidargumentexception.php2024-06-13 02:01 7.6K 
[   ]imagick.levelimage.php2024-06-13 02:01 7.6K 
[   ]function.ssh2-auth-hostbased-file.php2024-06-13 02:01 7.6K 
[   ]reflectionproperty.getdoccomment.php2024-06-13 02:01 7.6K 
[   ]imagickdraw.rotate.php2024-06-13 02:01 7.6K 
[   ]function.socket-write.php2024-06-13 02:01 7.6K 
[   ]function.hash-file.php2024-06-13 02:01 7.6K 
[   ]function.parse-ini-string.php2024-06-13 02:01 7.6K 
[   ]function.stripslashes.php2024-06-13 02:01 7.6K 
[   ]class.luasandboxruntimeerror.php2024-06-13 02:01 7.6K 
[   ]mongodb-driver-readpreference.getmodestring.php2024-06-13 02:01 7.6K 
[   ]function.session-cache-expire.php2024-06-13 02:01 7.6K 
[   ]class.lua.php2024-06-13 02:01 7.6K 
[   ]function.sqlsrv-free-stmt.php2024-06-13 02:01 7.6K 
[   ]tidy.getconfig.php2024-06-13 02:01 7.6K 
[   ]rrdgraph.setoptions.php2024-06-13 02:01 7.6K 
[   ]class.splheap.php2024-06-13 02:01 7.6K 
[   ]ziparchive.addpattern.php2024-06-13 02:01 7.6K 
[   ]class.parle-lexerexception.php2024-06-13 02:01 7.6K 
[   ]ds-sequence.filter.php2024-06-13 02:01 7.6K 
[   ]function.stream-copy-to-stream.php2024-06-13 02:01 7.6K 
[   ]function.array-combine.php2024-06-13 02:01 7.6K 
[   ]mongodb-driver-cursor.toarray.php2024-06-13 02:01 7.6K 
[   ]intlchar.toupper.php2024-06-13 02:01 7.6K 
[   ]function.variant-or.php2024-06-13 02:01 7.6K 
[   ]yaf-router.addconfig.php2024-06-13 02:01 7.6K 
[   ]function.mysql-fetch-lengths.php2024-06-13 02:01 7.6K 
[   ]phar.offsetset.php2024-06-13 02:01 7.6K 
[   ]imagickdraw.popdefs.php2024-06-13 02:01 7.6K 
[   ]function.pcntl-rfork.php2024-06-13 02:01 7.6K 
[   ]class.rararchive.php2024-06-13 02:01 7.6K 
[   ]imagick.setimagetickspersecond.php2024-06-13 02:01 7.6K 
[   ]class.luasandboxfatalerror.php2024-06-13 02:01 7.6K 
[   ]xsltprocessor.transformtodoc.php2024-06-13 02:01 7.6K 
[   ]class.parle-parserexception.php2024-06-13 02:01 7.6K 
[   ]yaf-route-map.assemble.php2024-06-13 02:01 7.6K 
[   ]class.pool.php2024-06-13 02:01 7.6K 
[   ]phardata.addfromstring.php2024-06-13 02:01 7.6K 
[   ]class.zookeeperoperationtimeoutexception.php2024-06-13 02:01 7.6K 
[   ]reflectionclass.hasmethod.php2024-06-13 02:01 7.6K 
[   ]dba.requirements.php2024-06-13 02:01 7.6K 
[   ]tidynode.ishtml.php2024-06-13 02:01 7.6K 
[   ]function.pg-cancel-query.php2024-06-13 02:01 7.6K 
[   ]refs.basic.php.php2024-06-13 02:01 7.6K 
[   ]function.ldap-errno.php2024-06-13 02:01 7.6K 
[   ]intlchar.charname.php2024-06-13 02:01 7.6K 
[   ]globiterator.construct.php2024-06-13 02:01 7.6K 
[   ]zookeeper.setacl.php2024-06-13 02:01 7.6K 
[   ]function.mysql-field-table.php2024-06-13 02:01 7.6K 
[   ]function.pg-meta-data.php2024-06-13 02:01 7.6K 
[   ]class.zookeepermarshallingexception.php2024-06-13 02:01 7.6K 
[   ]outcontrol.flushing-system-buffers.php2024-06-13 02:01 7.6K 
[   ]function.basename.php2024-06-13 02:01 7.6K 
[   ]function.grapheme-strripos.php2024-06-13 02:01 7.6K 
[   ]yaf-route-static.assemble.php2024-06-13 02:01 7.6K 
[   ]phar.setsignaturealgorithm.php2024-06-13 02:01 7.6K 
[   ]function.pg-copy-to.php2024-06-13 02:01 7.6K 
[   ]function.imagealphablending.php2024-06-13 02:01 7.6K 
[   ]class.zookeeperauthenticationexception.php2024-06-13 02:01 7.6K 
[   ]intldateformatter.getcalendarobject.php2024-06-13 02:01 7.5K 
[   ]class.zookeeperconnectionexception.php2024-06-13 02:01 7.5K 
[   ]reflectionclass.getreflectionconstants.php2024-06-13 02:01 7.5K 
[   ]class.ui-exception-runtimeexception.php2024-06-13 02:01 7.5K 
[   ]memcached.addserver.php2024-06-13 02:01 7.5K 
[   ]function.wincache-rplist-fileinfo.php2024-06-13 02:01 7.5K 
[   ]function.pg-end-copy.php2024-06-13 02:01 7.5K 
[   ]class.mysql-xdevapi-table.php2024-06-13 02:01 7.5K 
[   ]mysqlinfo.concepts.buffering.php2024-06-13 02:01 7.5K 
[   ]class.zookeepernonodeexception.php2024-06-13 02:01 7.5K 
[   ]function.db2-primary-keys.php2024-06-13 02:01 7.5K 
[   ]mysqli.get-server-info.php2024-06-13 02:01 7.5K 
[   ]function.pg-lo-import.php2024-06-13 02:01 7.5K 
[   ]function.radius-put-int.php2024-06-13 02:01 7.5K 
[   ]reflectionparameter.getdefaultvalueconstantname.php2024-06-13 02:01 7.5K 
[   ]function.openssl-pbkdf2.php2024-06-13 02:01 7.5K 
[   ]features.commandline.php2024-06-13 02:01 7.5K 
[   ]function.pg-last-error.php2024-06-13 02:01 7.5K 
[   ]function.pg-free-result.php2024-06-13 02:01 7.5K 
[   ]phptoken.is.php2024-06-13 02:01 7.5K 
[   ]function.apache-note.php2024-06-13 02:01 7.5K 
[   ]imagick.filter.php2024-06-13 02:01 7.5K 
[   ]domdocument.getelementbyid.php2024-06-13 02:01 7.5K 
[   ]mongodb-driver-cursor.getid.php2024-06-13 02:01 7.5K 
[   ]domdocument.getelementsbytagnamens.php2024-06-13 02:01 7.5K 
[   ]function.mb-strcut.php2024-06-13 02:01 7.5K 
[   ]function.stream-socket-accept.php2024-06-13 02:01 7.5K 
[   ]function.pg-field-type-oid.php2024-06-13 02:01 7.5K 
[   ]session.examples.basic.php2024-06-13 02:01 7.5K 
[   ]function.similar-text.php2024-06-13 02:01 7.5K 
[   ]function.xdiff-string-diff.php2024-06-13 02:01 7.5K 
[   ]ev.periodic-modes.php2024-06-13 02:01 7.5K 
[   ]function.array-pad.php2024-06-13 02:01 7.5K 
[   ]function.openssl-spki-export-challenge.php2024-06-13 02:01 7.5K 
[   ]function.jdtojewish.php2024-06-13 02:01 7.5K 
[   ]function.cubrid-lob-get.php2024-06-13 02:01 7.5K 
[   ]function.ssh2-exec.php2024-06-13 02:01 7.5K 
[   ]ds-vector.filter.php2024-06-13 02:01 7.5K 
[   ]function.wincache-ucache-clear.php2024-06-13 02:01 7.5K 
[   ]class.zookeepersessionexception.php2024-06-13 02:01 7.5K 
[   ]function.imagewebp.php2024-06-13 02:01 7.5K 
[   ]function.posix-mknod.php2024-06-13 02:01 7.5K 
[   ]exif.configuration.php2024-06-13 02:01 7.5K 
[   ]ref.eio.php2024-06-13 02:01 7.5K 
[   ]function.curl-setopt-array.php2024-06-13 02:01 7.5K 
[   ]rarexception.setusingexceptions.php2024-06-13 02:01 7.5K 
[   ]filesystem.configuration.php2024-06-13 02:01 7.5K 
[   ]function.mysql-close.php2024-06-13 02:01 7.5K 
[   ]messageformatter.geterrormessage.php2024-06-13 02:01 7.5K 
[   ]pharfileinfo.delmetadata.php2024-06-13 02:01 7.5K 
[   ]phardata.setmetadata.php2024-06-13 02:01 7.5K 
[   ]function.ctype-space.php2024-06-13 02:01 7.5K 
[   ]function.hash.php2024-06-13 02:01 7.5K 
[   ]streamwrapper.stream-set-option.php2024-06-13 02:01 7.5K 
[   ]datetime.createfromformat.php2024-06-13 02:01 7.5K 
[   ]security.database.storage.php2024-06-13 02:01 7.5K 
[   ]imagick.colormatriximage.php2024-06-13 02:01 7.5K 
[   ]class.luasandboxsyntaxerror.php2024-06-13 02:01 7.5K 
[   ]phar.setdefaultstub.php2024-06-13 02:01 7.5K 
[   ]class.luasandboxerrorerror.php2024-06-13 02:01 7.5K 
[   ]splfileobject.fscanf.php2024-06-13 02:01 7.5K 
[   ]mysqli.connect-error.php2024-06-13 02:01 7.5K 
[   ]intlchar.istitle.php2024-06-13 02:01 7.5K 
[   ]ds-deque.filter.php2024-06-13 02:01 7.5K 
[   ]imagick.thumbnailimage.php2024-06-13 02:01 7.5K 
[   ]function.ldap-rename.php2024-06-13 02:01 7.5K 
[   ]dateperiod.getenddate.php2024-06-13 02:01 7.5K 
[   ]ref.stream.php2024-06-13 02:01 7.5K 
[   ]function.intdiv.php2024-06-13 02:01 7.5K 
[   ]domdocumentfragment.prepend.php2024-06-13 02:01 7.5K 
[   ]intlcalendar.gettimezone.php2024-06-13 02:01 7.5K 
[   ]function.ftp-set-option.php2024-06-13 02:01 7.5K 
[TXT]refs.xml.php2024-06-13 02:01 7.5K 
[   ]function.ini-parse-quantity.php2024-06-13 02:01 7.5K 
[   ]function.ftp-chdir.php2024-06-13 02:01 7.5K 
[   ]function.variant-and.php2024-06-13 02:01 7.4K 
[   ]function.get-defined-constants.php2024-06-13 02:01 7.4K 
[   ]refs.basic.vartype.php2024-06-13 02:01 7.4K 
[   ]ref.pdo-sqlsrv.connection.php2024-06-13 02:01 7.4K 
[   ]mysqli.get-server-version.php2024-06-13 02:01 7.4K 
[   ]function.eio-fallocate.php2024-06-13 02:01 7.4K 
[   ]function.db2-escape-string.php2024-06-13 02:01 7.4K 
[   ]class.mysql-xdevapi-sqlstatementresult.php2024-06-13 02:01 7.4K 
[   ]function.sapi-windows-set-ctrl-handler.php2024-06-13 02:01 7.4K 
[   ]function.hash-update-stream.php2024-06-13 02:01 7.4K 
[   ]function.eio-cancel.php2024-06-13 02:01 7.4K 
[   ]sqlite3.construct.php2024-06-13 02:01 7.4K 
[   ]function.ctype-print.php2024-06-13 02:01 7.4K 
[   ]function.iconv-strpos.php2024-06-13 02:01 7.4K 
[   ]book.svn.php2024-06-13 02:01 7.4K 
[   ]class.mongodb-driver-monitoring-commandstartedevent.php2024-06-13 02:01 7.4K 
[   ]function.mysql-unbuffered-query.php2024-06-13 02:01 7.4K 
[   ]function.pg-result-seek.php2024-06-13 02:01 7.4K 
[   ]function.imap-mail.php2024-06-13 02:01 7.4K 
[   ]ds-sequence.sorted.php2024-06-13 02:01 7.4K 
[   ]function.dba-fetch.php2024-06-13 02:01 7.4K 
[   ]domdocument.save.php2024-06-13 02:01 7.4K 
[   ]mysql-xdevapi-result.getautoincrementvalue.php2024-06-13 02:01 7.4K 
[   ]function.posix-eaccess.php2024-06-13 02:01 7.4K 
[   ]reflectionmethod.invokeargs.php2024-06-13 02:01 7.4K 
[   ]mysql-xdevapi-docresult.construct.php2024-06-13 02:01 7.4K 
[   ]ds-sequence.sort.php2024-06-13 02:01 7.4K 
[   ]function.count-chars.php2024-06-13 02:01 7.4K 
[   ]ds-set.filter.php2024-06-13 02:01 7.4K 
[   ]class.zookeeperexception.php2024-06-13 02:01 7.4K 
[   ]function.curl-exec.php2024-06-13 02:01 7.4K 
[   ]function.rnp-op-generate-key.php2024-06-13 02:01 7.4K 
[   ]quickhashstringinthash.update.php2024-06-13 02:01 7.4K 
[   ]mongodb-driver-cursor.getserver.php2024-06-13 02:01 7.4K 
[   ]function.bcmod.php2024-06-13 02:01 7.4K 
[   ]function.pcntl-sigwaitinfo.php2024-06-13 02:01 7.4K 
[   ]function.gmp-random-seed.php2024-06-13 02:01 7.4K 
[   ]intlchar.isuwhitespace.php2024-06-13 02:01 7.4K 
[   ]intlcalendar.getkeywordvaluesforlocale.php2024-06-13 02:01 7.4K 
[   ]mongodb-driver-readpreference.getmode.php2024-06-13 02:01 7.4K 
[   ]memcached.prepend.php2024-06-13 02:01 7.4K 
[   ]class.ui-controls-picker.php2024-06-13 02:01 7.4K 
[   ]function.svn-checkout.php2024-06-13 02:01 7.4K 
[   ]migration56.new-functions.php2024-06-13 02:01 7.4K 
[   ]imagickpixel.sethsl.php2024-06-13 02:01 7.4K 
[   ]eventdnsbase.construct.php2024-06-13 02:01 7.4K 
[   ]domdocumentfragment.append.php2024-06-13 02:01 7.4K 
[   ]function.ctype-graph.php2024-06-13 02:01 7.4K 
[   ]snmp.setsecurity.php2024-06-13 02:01 7.4K 
[   ]memcached.append.php2024-06-13 02:01 7.4K 
[   ]function.uopz-set-property.php2024-06-13 02:01 7.4K 
[   ]filesystemiterator.construct.php2024-06-13 02:01 7.4K 
[   ]function.imagecolorsforindex.php2024-06-13 02:01 7.4K 
[   ]function.socket-create-listen.php2024-06-13 02:01 7.4K 
[   ]lua.call.php2024-06-13 02:01 7.4K 
[   ]control-structures.elseif.php2024-06-13 02:01 7.4K 
[   ]function.stream-socket-sendto.php2024-06-13 02:01 7.4K 
[   ]xmlwriter.startattributens.php2024-06-13 02:01 7.4K 
[   ]function.grapheme-strstr.php2024-06-13 02:01 7.4K 
[   ]function.curl-share-init.php2024-06-13 02:01 7.4K 
[   ]memcached.getserverbykey.php2024-06-13 02:01 7.4K 
[   ]function.socket-last-error.php2024-06-13 02:01 7.4K 
[   ]class.mongodb-bson-int64.php2024-06-13 02:01 7.4K 
[   ]resourcebundle.get.php2024-06-13 02:01 7.4K 
[   ]imagick.subimagematch.php2024-06-13 02:01 7.4K 
[   ]book.sockets.php2024-06-13 02:01 7.4K 
[   ]xmlwriter.startdocument.php2024-06-13 02:01 7.4K 
[   ]imagickpixel.setcolor.php2024-06-13 02:01 7.4K 
[   ]function.curl-escape.php2024-06-13 02:01 7.4K 
[   ]solrquery.addgroupsortfield.php2024-06-13 02:01 7.4K 
[   ]domdocument.savehtml.php2024-06-13 02:01 7.4K 
[   ]about.prototypes.php2024-06-13 02:01 7.4K 
[   ]phar.isbuffering.php2024-06-13 02:01 7.4K 
[   ]class.swoole-buffer.php2024-06-13 02:01 7.4K 
[   ]class.memcachedexception.php2024-06-13 02:01 7.4K 
[   ]function.openssl-cms-verify.php2024-06-13 02:01 7.4K 
[   ]class.swoole-connection-iterator.php2024-06-13 02:01 7.4K 
[   ]class.ui-controls-check.php2024-06-13 02:01 7.4K 
[   ]imagickdraw.settextdecoration.php2024-06-13 02:01 7.4K 
[   ]function.cubrid-field-type.php2024-06-13 02:01 7.4K 
[   ]class.yaf-route-rewrite.php2024-06-13 02:01 7.4K 
[   ]function.cubrid-data-seek.php2024-06-13 02:01 7.3K 
[   ]function.sleep.php2024-06-13 02:01 7.3K 
[   ]tidy.getopt.php2024-06-13 02:01 7.3K 
[   ]function.gmp-random-range.php2024-06-13 02:01 7.3K 
[   ]function.enchant-dict-suggest.php2024-06-13 02:01 7.3K 
[   ]domelement.after.php2024-06-13 02:01 7.3K 
[   ]phar.setmetadata.php2024-06-13 02:01 7.3K 
[   ]function.odbc-setoption.php2024-06-13 02:01 7.3K 
[   ]quickhashintset.add.php2024-06-13 02:01 7.3K 
[   ]function.mb-substitute-character.php2024-06-13 02:01 7.3K 
[   ]ds-vector.sorted.php2024-06-13 02:01 7.3K 
[   ]function.odbc-execute.php2024-06-13 02:01 7.3K 
[   ]function.imagepalettecopy.php2024-06-13 02:01 7.3K 
[   ]splobjectstorage.getinfo.php2024-06-13 02:01 7.3K 
[   ]function.ibase-query.php2024-06-13 02:01 7.3K 
[   ]simplexmlelement.xpath.php2024-06-13 02:01 7.3K 
[   ]quickhashintset.loadfromstring.php2024-06-13 02:01 7.3K 
[   ]ds-vector.sort.php2024-06-13 02:01 7.3K 
[   ]class.compersisthelper.php2024-06-13 02:01 7.3K 
[   ]function.mqseries-begin.php2024-06-13 02:01 7.3K 
[   ]memcache.connect.php2024-06-13 02:01 7.3K 
[   ]function.cubrid-result.php2024-06-13 02:01 7.3K 
[   ]reflectionparameter.getdefaultvalue.php2024-06-13 02:01 7.3K 
[   ]sqlite3.open.php2024-06-13 02:01 7.3K 
[   ]ds-deque.sorted.php2024-06-13 02:01 7.3K 
[   ]intlchar.iswhitespace.php2024-06-13 02:01 7.3K 
[   ]function.cubrid-field-table.php2024-06-13 02:01 7.3K 
[   ]ds-hashable.hash.php2024-06-13 02:01 7.3K 
[   ]recursivearrayiterator.getchildren.php2024-06-13 02:01 7.3K 
[   ]function.gnupg-init.php2024-06-13 02:01 7.3K 
[   ]migration73.new-functions.php2024-06-13 02:01 7.3K 
[   ]mysqli.stat.php2024-06-13 02:01 7.3K 
[   ]function.geoip-time-zone-by-country-and-region.php2024-06-13 02:01 7.3K 
[   ]class.swoole-event.php2024-06-13 02:01 7.3K 
[   ]function.dir.php2024-06-13 02:01 7.3K 
[   ]ds-deque.sort.php2024-06-13 02:01 7.3K 
[   ]intlcalendar.setskippedwalltimeoption.php2024-06-13 02:01 7.3K 
[   ]function.xdiff-file-diff.php2024-06-13 02:01 7.3K 
[   ]function.curl-init.php2024-06-13 02:01 7.3K 
[   ]function.odbc-binmode.php2024-06-13 02:01 7.3K 
[   ]domcharacterdata.before.php2024-06-13 02:01 7.3K 
[   ]language.enumerations.examples.php2024-06-13 02:01 7.3K 
[   ]function.win32-send-custom-control.php2024-06-13 02:01 7.3K 
[   ]apcu.constants.php2024-06-13 02:01 7.3K 
[TXT]refs.basic.text.php2024-06-13 02:01 7.3K 
[   ]intlgregoriancalendar.createfromdate.php2024-06-13 02:01 7.3K 
[   ]function.imageistruecolor.php2024-06-13 02:01 7.3K 
[   ]book.curl.php2024-06-13 02:01 7.3K 
[   ]refs.international.php2024-06-13 02:01 7.3K 
[   ]reflection.getmodifiernames.php2024-06-13 02:01 7.3K 
[   ]function.easter-days.php2024-06-13 02:01 7.3K 
[   ]mysql-xdevapi-schema.getcollectionastable.php2024-06-13 02:01 7.3K 
[   ]function.ps-hyphenate.php2024-06-13 02:01 7.3K 
[   ]function.ftp-pasv.php2024-06-13 02:01 7.3K 
[   ]function.svn-ls.php2024-06-13 02:01 7.3K 
[   ]function.array-flip.php2024-06-13 02:01 7.3K 
[   ]locale.parselocale.php2024-06-13 02:01 7.3K 
[   ]function.mb-ereg-replace.php2024-06-13 02:01 7.3K 
[   ]intlchar.isupper.php2024-06-13 02:01 7.3K 
[   ]mysql-xdevapi-collectionfind.execute.php2024-06-13 02:01 7.3K 
[   ]intlchar.islower.php2024-06-13 02:01 7.3K 
[   ]function.snmp-set-quick-print.php2024-06-13 02:01 7.3K 
[   ]function.sem-get.php2024-06-13 02:01 7.3K 
[   ]mysql-xdevapi-collectionremove.construct.php2024-06-13 02:01 7.3K 
[   ]function.ps-add-note.php2024-06-13 02:01 7.3K 
[   ]function.socket-strerror.php2024-06-13 02:01 7.3K 
[   ]function.apcu-store.php2024-06-13 02:01 7.3K 
[   ]wkhtmltox-pdf-converter.construct.php2024-06-13 02:01 7.2K 
[   ]function.pg-lo-unlink.php2024-06-13 02:01 7.2K 
[   ]migration70.new-functions.php2024-06-13 02:01 7.2K 
[   ]language.oop5.serialization.php2024-06-13 02:01 7.2K 
[   ]ds-set.sorted.php2024-06-13 02:01 7.2K 
[   ]stomp.setreadtimeout.php2024-06-13 02:01 7.2K 
[   ]function.bcpowmod.php2024-06-13 02:01 7.2K 
[   ]function.pg-field-type.php2024-06-13 02:01 7.2K 
[   ]function.uopz-function.php2024-06-13 02:01 7.2K 
[   ]function.openssl-public-encrypt.php2024-06-13 02:01 7.2K 
[   ]quickhashintstringhash.loadfromstring.php2024-06-13 02:01 7.2K 
[   ]ds-set.sort.php2024-06-13 02:01 7.2K 
[   ]mysql-xdevapi-tableselect.offset.php2024-06-13 02:01 7.2K 
[   ]function.imageinterlace.php2024-06-13 02:01 7.2K 
[   ]function.hash-equals.php2024-06-13 02:01 7.2K 
[   ]function.gnupg-decryptverify.php2024-06-13 02:01 7.2K 
[   ]class.domnamednodemap.php2024-06-13 02:01 7.2K 
[   ]function.grapheme-strrpos.php2024-06-13 02:01 7.2K 
[   ]function.dechex.php2024-06-13 02:01 7.2K 
[   ]svm.examples.php2024-06-13 02:01 7.2K 
[   ]function.eio-sync-file-range.php2024-06-13 02:01 7.2K 
[   ]function.soundex.php2024-06-13 02:01 7.2K 
[   ]memcached.setoption.php2024-06-13 02:01 7.2K 
[   ]reflectionclass.isinstantiable.php2024-06-13 02:01 7.2K 
[   ]function.srand.php2024-06-13 02:01 7.2K 
[   ]function.ldap-sort.php2024-06-13 02:01 7.2K 
[   ]function.fpassthru.php2024-06-13 02:01 7.2K 
[   ]sqlite3.enableexceptions.php2024-06-13 02:01 7.2K 
[   ]mysqli.connect-errno.php2024-06-13 02:01 7.2K 
[   ]memcache.replace.php2024-06-13 02:01 7.2K 
[   ]function.class-implements.php2024-06-13 02:01 7.2K 
[   ]ziparchive.setexternalattributesname.php2024-06-13 02:01 7.2K 
[   ]solrcollapsefunction.construct.php2024-06-13 02:01 7.2K 
[   ]function.dio-seek.php2024-06-13 02:01 7.2K 
[   ]function.wincache-ocache-meminfo.php2024-06-13 02:01 7.2K 
[   ]function.ord.php2024-06-13 02:01 7.2K 
[   ]arrayiterator.asort.php2024-06-13 02:01 7.2K 
[   ]class.commonmark-cql.php2024-06-13 02:01 7.2K 
[   ]function.ssh2-sftp-lstat.php2024-06-13 02:01 7.2K 
[   ]intro.cmark.php2024-06-13 02:01 7.2K 
[   ]domimplementation.createdocument.php2024-06-13 02:01 7.2K 
[   ]intlchar.isxdigit.php2024-06-13 02:01 7.2K 
[   ]imagick.setimageartifact.php2024-06-13 02:01 7.2K 
[   ]class.apcuiterator.php2024-06-13 02:01 7.2K 
[   ]migration83.new-functions.php2024-06-13 02:01 7.2K 
[   ]install.windows.apache2.php2024-06-13 02:01 7.2K 
[   ]function.openssl-private-decrypt.php2024-06-13 02:01 7.2K 
[   ]function.openssl-pkey-new.php2024-06-13 02:01 7.2K 
[   ]stomp.getsessionid.php2024-06-13 02:01 7.2K 
[   ]resourcebundle.geterrormessage.php2024-06-13 02:01 7.2K 
[   ]limititerator.construct.php2024-06-13 02:01 7.2K 
[   ]function.pg-lo-close.php2024-06-13 02:01 7.2K 
[   ]mongodb-driver-manager.selectserver.php2024-06-13 02:01 7.2K 
[   ]mongodb-bson-javascript.construct.php2024-06-13 02:01 7.2K 
[   ]class.ui-draw-brush-gradient.php2024-06-13 02:01 7.2K 
[   ]arrayiterator.ksort.php2024-06-13 02:01 7.2K 
[   ]locale.getkeywords.php2024-06-13 02:01 7.2K 
[   ]function.shuffle.php2024-06-13 02:01 7.2K 
[   ]function.mysql-get-server-info.php2024-06-13 02:01 7.2K 
[   ]function.mqseries-open.php2024-06-13 02:01 7.2K 
[   ]class.filteriterator.php2024-06-13 02:01 7.2K 
[   ]random-randomizer.shufflearray.php2024-06-13 02:01 7.2K 
[   ]intlchar.charfromname.php2024-06-13 02:01 7.2K 
[   ]ds-sequence.slice.php2024-06-13 02:01 7.2K 
[   ]sqlite3.constants.php2024-06-13 02:01 7.2K 
[   ]function.tempnam.php2024-06-13 02:01 7.2K 
[   ]control-structures.goto.php2024-06-13 02:01 7.2K 
[   ]mongodb-driver-writeconcern.bsonserialize.php2024-06-13 02:01 7.2K 
[   ]yaf-dispatcher.catchexception.php2024-06-13 02:01 7.2K 
[   ]quickhashintset.loadfromfile.php2024-06-13 02:01 7.2K 
[   ]math.constants.php2024-06-13 02:01 7.2K 
[   ]book.uodbc.php2024-06-13 02:01 7.2K 
[   ]function.ps-shading.php2024-06-13 02:01 7.2K 
[   ]mysql-xdevapi-tableselect.construct.php2024-06-13 02:01 7.2K 
[   ]splfileobject.key.php2024-06-13 02:01 7.2K 
[   ]function.mb-eregi-replace.php2024-06-13 02:01 7.2K 
[   ]book.posix.php2024-06-13 02:01 7.2K 
[   ]mysql-xdevapi-table.select.php2024-06-13 02:01 7.1K 
[   ]seaslog.analyzercount.php2024-06-13 02:01 7.1K 
[   ]class.throwable.php2024-06-13 02:01 7.1K 
[   ]ref.svn.php2024-06-13 02:01 7.1K 
[   ]yaf-plugin-abstract.routershutdown.php2024-06-13 02:01 7.1K 
[   ]splobjectstorage.setinfo.php2024-06-13 02:01 7.1K 
[   ]function.pg-fetch-all-columns.php2024-06-13 02:01 7.1K 
[   ]book.sqlite3.php2024-06-13 02:01 7.1K 
[   ]mysql-xdevapi-collection.getone.php2024-06-13 02:01 7.1K 
[   ]memcache.decrement.php2024-06-13 02:01 7.1K 
[   ]intro.dbase.php2024-06-13 02:01 7.1K 
[   ]function.sodium-crypto-box-seal.php2024-06-13 02:01 7.1K 
[   ]function.simdjson-key-value.php2024-06-13 02:01 7.1K 
[   ]function.cubrid-lob-close.php2024-06-13 02:01 7.1K 
[   ]ds-set.contains.php2024-06-13 02:01 7.1K 
[   ]function.ssh2-auth-pubkey-file.php2024-06-13 02:01 7.1K 
[   ]function.array-key-first.php2024-06-13 02:01 7.1K 
[   ]function.crc32.php2024-06-13 02:01 7.1K 
[   ]function.wincache-rplist-meminfo.php2024-06-13 02:01 7.1K 
[   ]imagick.transparentpaintimage.php2024-06-13 02:01 7.1K 
[   ]language.references.return.php2024-06-13 02:01 7.1K 
[   ]mysqli.quickstart.transactions.php2024-06-13 02:01 7.1K 
[   ]function.is-object.php2024-06-13 02:01 7.1K 
[   ]function.ftp-rename.php2024-06-13 02:01 7.1K 
[   ]mongodb-driver-writeresult.getwriteconcernerror.php2024-06-13 02:01 7.1K 
[   ]intro.image.php2024-06-13 02:01 7.1K 
[   ]function.ldap-sasl-bind.php2024-06-13 02:01 7.1K 
[   ]memcache.add.php2024-06-13 02:01 7.1K 
[   ]function.ssh2-sftp-stat.php2024-06-13 02:01 7.1K 
[   ]function.imagecreatetruecolor.php2024-06-13 02:01 7.1K 
[   ]quickhashintstringhash.update.php2024-06-13 02:01 7.1K 
[   ]function.file-exists.php2024-06-13 02:01 7.1K 
[   ]datetime.settime.php2024-06-13 02:01 7.1K 
[   ]domdocument.replacechildren.php2024-06-13 02:01 7.1K 
[   ]zookeeper.set.php2024-06-13 02:01 7.1K 
[   ]function.strncasecmp.php2024-06-13 02:01 7.1K 
[   ]function.array-push.php2024-06-13 02:01 7.1K 
[   ]datetimezone.getoffset.php2024-06-13 02:01 7.1K 
[   ]function.ctype-alpha.php2024-06-13 02:01 7.1K 
[   ]function.bcpow.php2024-06-13 02:01 7.1K 
[   ]function.bcmul.php2024-06-13 02:01 7.1K 
[   ]function.openssl-get-curve-names.php2024-06-13 02:01 7.1K 
[   ]function.geoip-region-name-by-code.php2024-06-13 02:01 7.1K 
[   ]refs.database.vendors.php2024-06-13 02:01 7.1K 
[   ]mbstring.overload.php2024-06-13 02:01 7.1K 
[   ]function.pg-lo-read.php2024-06-13 02:01 7.1K 
[   ]function.cubrid-field-name.php2024-06-13 02:01 7.1K 
[   ]function.socket-accept.php2024-06-13 02:01 7.1K 
[   ]function.mysql-get-host-info.php2024-06-13 02:01 7.1K 
[   ]function.snmpwalk.php2024-06-13 02:01 7.1K 
[   ]function.ps-findfont.php2024-06-13 02:01 7.1K 
[   ]evstat.construct.php2024-06-13 02:01 7.1K 
[   ]function.win32-delete-service.php2024-06-13 02:01 7.1K 
[   ]zmqsocket.connect.php2024-06-13 02:01 7.1K 
[   ]tidy.root.php2024-06-13 02:01 7.1K 
[   ]mhash.constants.php2024-06-13 02:01 7.1K 
[   ]domelement.prepend.php2024-06-13 02:01 7.1K 
[   ]intlcalendar.todatetime.php2024-06-13 02:01 7.1K 
[   ]xmlwriter.startdtd.php2024-06-13 02:01 7.1K 
[   ]function.class-exists.php2024-06-13 02:01 7.1K 
[   ]pdo.begintransaction.php2024-06-13 02:01 7.1K 
[   ]function.cal-from-jd.php2024-06-13 02:01 7.1K 
[   ]class.gearmanexception.php2024-06-13 02:01 7.1K 
[   ]mysql-xdevapi-rowresult.getcolumns.php2024-06-13 02:01 7.1K 
[   ]function.cubrid-is-instance.php2024-06-13 02:01 7.1K 
[   ]ds-sequence.contains.php2024-06-13 02:01 7.1K 
[   ]class.splminheap.php2024-06-13 02:01 7.1K 
[   ]function.ftp-mdtm.php2024-06-13 02:01 7.1K 
[   ]class.splmaxheap.php2024-06-13 02:01 7.1K 
[   ]function.ldap-mod-add.php2024-06-13 02:01 7.1K 
[   ]function.dbase-get-header-info.php2024-06-13 02:01 7.1K 
[   ]function.uopz-add-function.php2024-06-13 02:01 7.1K 
[   ]function.highlight-string.php2024-06-13 02:01 7.0K 
[   ]function.cubrid-num-rows.php2024-06-13 02:01 7.0K 
[   ]ds-vector.slice.php2024-06-13 02:01 7.0K 
[   ]yaf-view-simple.assignref.php2024-06-13 02:01 7.0K 
[   ]function.db2-num-fields.php2024-06-13 02:01 7.0K 
[   ]mongodb-driver-server.getlatency.php2024-06-13 02:01 7.0K 
[   ]phar.copy.php2024-06-13 02:01 7.0K 
[   ]function.posix-getpwnam.php2024-06-13 02:01 7.0K 
[   ]class.ocicollection.php2024-06-13 02:01 7.0K 
[   ]function.yaz-es.php2024-06-13 02:01 7.0K 
[   ]book.oauth.php2024-06-13 02:01 7.0K 
[   ]function.mb-strtoupper.php2024-06-13 02:01 7.0K 
[   ]function.mb-internal-encoding.php2024-06-13 02:01 7.0K 
[   ]class.ds-stack.php2024-06-13 02:01 7.0K 
[   ]numberformatter.geterrorcode.php2024-06-13 02:01 7.0K 
[   ]function.get-defined-functions.php2024-06-13 02:01 7.0K 
[   ]domelement.append.php2024-06-13 02:01 7.0K 
[   ]function.cubrid-insert-id.php2024-06-13 02:01 7.0K 
[   ]domdocument.xinclude.php2024-06-13 02:01 7.0K 
[   ]function.usleep.php2024-06-13 02:01 7.0K 
[   ]mysqli.get-host-info.php2024-06-13 02:01 7.0K 
[   ]xmlwriter.startelementns.php2024-06-13 02:01 7.0K 
[   ]reflectionproperty.getdefaultvalue.php2024-06-13 02:01 7.0K 
[   ]recursivearrayiterator.haschildren.php2024-06-13 02:01 7.0K 
[   ]memcached.setbykey.php2024-06-13 02:01 7.0K 
[   ]wrappers.audio.php2024-06-13 02:01 7.0K 
[   ]function.pg-lo-tell.php2024-06-13 02:01 7.0K 
[   ]function.cubrid-disconnect.php2024-06-13 02:01 7.0K 
[   ]function.strncmp.php2024-06-13 02:01 7.0K 
[   ]random-engine-mt19937.construct.php2024-06-13 02:01 7.0K 
[   ]function.wincache-fcache-meminfo.php2024-06-13 02:01 7.0K 
[   ]function.trader-sarext.php2024-06-13 02:01 7.0K 
[   ]class.parallel-events.php2024-06-13 02:01 7.0K 
[   ]function.ibase-execute.php2024-06-13 02:01 7.0K 
[   ]function.xhprof-enable.php2024-06-13 02:01 7.0K 
[   ]reflectionproperty.isinitialized.php2024-06-13 02:01 7.0K 
[   ]function.variant-imp.php2024-06-13 02:01 7.0K 
[   ]function.posix-getpwuid.php2024-06-13 02:01 7.0K 
[   ]function.mb-strtolower.php2024-06-13 02:01 7.0K 
[   ]function.mb-chr.php2024-06-13 02:01 7.0K 
[   ]mysql-xdevapi-result.construct.php2024-06-13 02:01 7.0K 
[   ]class.mysql-xdevapi-columnresult.php2024-06-13 02:01 7.0K 
[   ]function.curl-multi-strerror.php2024-06-13 02:01 7.0K 
[   ]function.array-is-list.php2024-06-13 02:01 7.0K 
[   ]ev.recommendedbackends.php2024-06-13 02:01 7.0K 
[   ]function.msg-stat-queue.php2024-06-13 02:01 7.0K 
[   ]ds-deque.slice.php2024-06-13 02:01 7.0K 
[   ]solrquery.addfacetfield.php2024-06-13 02:01 7.0K 
[   ]function.var-dump.php2024-06-13 02:01 7.0K 
[   ]pharfileinfo.getcompressedsize.php2024-06-13 02:01 7.0K 
[   ]function.is-a.php2024-06-13 02:01 7.0K 
[   ]class.intlpartsiterator.php2024-06-13 02:01 7.0K 
[   ]intlchar.isuuppercase.php2024-06-13 02:01 7.0K 
[   ]function.ftp-chmod.php2024-06-13 02:01 7.0K 
[   ]splfileobject.flock.php2024-06-13 02:01 7.0K 
[   ]imagickpixeliterator.setiteratorrow.php2024-06-13 02:01 7.0K 
[   ]intlchar.fordigit.php2024-06-13 02:01 7.0K 
[   ]migration56.changed-functions.php2024-06-13 02:01 7.0K 
[   ]function.password-verify.php2024-06-13 02:01 7.0K 
[   ]yaf-response-abstract.getbody.php2024-06-13 02:01 7.0K 
[   ]mysql-xdevapi-baseresult.getwarnings.php2024-06-13 02:01 7.0K 
[   ]syncevent.construct.php2024-06-13 02:01 7.0K 
[   ]mysql-xdevapi-tableselect.lockexclusive.php2024-06-13 02:01 7.0K 
[   ]function.date-default-timezone-get.php2024-06-13 02:01 7.0K 
[   ]function.array-intersect.php2024-06-13 02:01 7.0K 
[   ]function.http-response-code.php2024-06-13 02:01 7.0K 
[   ]function.openssl-get-md-methods.php2024-06-13 02:01 7.0K 
[   ]ds-vector.contains.php2024-06-13 02:01 7.0K 
[   ]function.inflate-init.php2024-06-13 02:01 7.0K 
[   ]imagick.queryformats.php2024-06-13 02:01 7.0K 
[   ]function.mysql-field-len.php2024-06-13 02:01 7.0K 
[   ]reflectionmethod.invoke.php2024-06-13 02:01 7.0K 
[   ]mongodb-bson-unserializable.bsonunserialize.php2024-06-13 02:01 7.0K 
[   ]function.socket-send.php2024-06-13 02:01 7.0K 
[   ]function.rnp-op-verify-detached.php2024-06-13 02:01 7.0K 
[   ]function.ldap-mod-replace.php2024-06-13 02:01 7.0K 
[   ]reflectionnamedtype.isbuiltin.php2024-06-13 02:01 7.0K 
[   ]function.pg-affected-rows.php2024-06-13 02:01 7.0K 
[   ]function.enchant-broker-request-dict.php2024-06-13 02:01 7.0K 
[   ]intlchar.isulowercase.php2024-06-13 02:01 7.0K 
[   ]function.nl2br.php2024-06-13 02:01 7.0K 
[   ]function.imap-listscan.php2024-06-13 02:01 7.0K 
[   ]function.dom-import-simplexml.php2024-06-13 02:01 7.0K 
[   ]intlchar.isidpart.php2024-06-13 02:01 7.0K 
[   ]function.pg-close.php2024-06-13 02:01 7.0K 
[   ]function.pg-client-encoding.php2024-06-13 02:01 7.0K 
[   ]imagickkernel.getmatrix.php2024-06-13 02:01 7.0K 
[   ]xsltprocessor.registerphpfunctions.php2024-06-13 02:01 7.0K 
[   ]function.ps-open-image.php2024-06-13 02:01 6.9K 
[   ]function.openssl-private-encrypt.php2024-06-13 02:01 6.9K 
[   ]function.proc-get-status.php2024-06-13 02:01 6.9K 
[   ]fdf.examples.php2024-06-13 02:01 6.9K 
[   ]class.closure.php2024-06-13 02:01 6.9K 
[   ]mongodb-bson-regex.construct.php2024-06-13 02:01 6.9K 
[   ]function.snmp2-walk.php2024-06-13 02:01 6.9K 
[   ]class.yar-server-exception.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-tableselect.lockshared.php2024-06-13 02:01 6.9K 
[   ]ds-deque.contains.php2024-06-13 02:01 6.9K 
[   ]function.yaz-itemorder.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-collectionfind.construct.php2024-06-13 02:01 6.9K 
[   ]function.filectime.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-collection.dropindex.php2024-06-13 02:01 6.9K 
[   ]function.pg-set-error-context-visibility.php2024-06-13 02:01 6.9K 
[   ]function.eio-seek.php2024-06-13 02:01 6.9K 
[   ]function.oci-statement-type.php2024-06-13 02:01 6.9K 
[   ]memcache.increment.php2024-06-13 02:01 6.9K 
[   ]function.gzencode.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-sqlstatementresult.fetchall.php2024-06-13 02:01 6.9K 
[   ]function.runkit7-method-copy.php2024-06-13 02:01 6.9K 
[   ]function.dbase-numrecords.php2024-06-13 02:01 6.9K 
[   ]domelement.before.php2024-06-13 02:01 6.9K 
[   ]function.dbase-add-record.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-schema.gettables.php2024-06-13 02:01 6.9K 
[   ]install.unix.debian.php2024-06-13 02:01 6.9K 
[   ]zmqcontext.getsocket.php2024-06-13 02:01 6.9K 
[   ]pharfileinfo.construct.php2024-06-13 02:01 6.9K 
[   ]function.gnupg-encryptsign.php2024-06-13 02:01 6.9K 
[   ]quickhashinthash.loadfromstring.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-collectionfind.lockexclusive.php2024-06-13 02:01 6.9K 
[   ]class.ui-controls-separator.php2024-06-13 02:01 6.9K 
[   ]solrquery.setexpand.php2024-06-13 02:01 6.9K 
[   ]ds-set.slice.php2024-06-13 02:01 6.9K 
[   ]function.dio-tcsetattr.php2024-06-13 02:01 6.9K 
[   ]function.set-exception-handler.php2024-06-13 02:01 6.9K 
[   ]class.zmqdevice.php2024-06-13 02:01 6.9K 
[   ]function.curl_upkeep.php2024-06-13 02:01 6.9K 
[   ]imagick.scaleimage.php2024-06-13 02:01 6.9K 
[   ]function.openssl-pkey-export-to-file.php2024-06-13 02:01 6.9K 
[   ]function.ps-add-pdflink.php2024-06-13 02:01 6.9K 
[   ]class.hrtime-stopwatch.php2024-06-13 02:01 6.9K 
[   ]oauthprovider.generatetoken.php2024-06-13 02:01 6.9K 
[   ]function.class-parents.php2024-06-13 02:01 6.9K 
[   ]function.ftp-mkdir.php2024-06-13 02:01 6.9K 
[   ]vtiful-kernel-excel.insertFormula.php2024-06-13 02:01 6.9K 
[   ]function.pspell-config-repl.php2024-06-13 02:01 6.9K 
[   ]function.posix-fpathconf.php2024-06-13 02:01 6.9K 
[   ]function.base-convert.php2024-06-13 02:01 6.9K 
[   ]function.openssl-pkcs7-read.php2024-06-13 02:01 6.9K 
[   ]function.yaz-set-option.php2024-06-13 02:01 6.9K 
[   ]curlstringfile.construct.php2024-06-13 02:01 6.9K 
[   ]function.fileatime.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-rowresult.getwarnings.php2024-06-13 02:01 6.9K 
[   ]collator.getsortkey.php2024-06-13 02:01 6.9K 
[   ]domnode.removechild.php2024-06-13 02:01 6.9K 
[   ]imagickkernel.addkernel.php2024-06-13 02:01 6.9K 
[   ]function.cubrid-unbuffered-query.php2024-06-13 02:01 6.9K 
[   ]function.cubrid-lob-send.php2024-06-13 02:01 6.9K 
[   ]imagick.adaptiveblurimage.php2024-06-13 02:01 6.9K 
[   ]array.sorting.php2024-06-13 02:01 6.9K 
[   ]mongodb-driver-cursorid.tostring.php2024-06-13 02:01 6.9K 
[   ]vtiful-kernel-excel.insertText.php2024-06-13 02:01 6.9K 
[   ]function.ps-begin-page.php2024-06-13 02:01 6.9K 
[   ]intlchar.isjavaidpart.php2024-06-13 02:01 6.9K 
[   ]splfileobject.setcsvcontrol.php2024-06-13 02:01 6.9K 
[   ]function.shmop-read.php2024-06-13 02:01 6.9K 
[   ]apcuiterator.construct.php2024-06-13 02:01 6.9K 
[   ]syncsharedmemory.write.php2024-06-13 02:01 6.9K 
[   ]function.mcrypt-create-iv.php2024-06-13 02:01 6.9K 
[   ]function.mb-strrpos.php2024-06-13 02:01 6.9K 
[   ]imagick.chopimage.php2024-06-13 02:01 6.9K 
[   ]function.chown.php2024-06-13 02:01 6.9K 
[   ]reflectionclass.getdefaultproperties.php2024-06-13 02:01 6.9K 
[   ]mongodb-driver-bulkwrite.count.php2024-06-13 02:01 6.9K 
[   ]function.ftp-nlist.php2024-06-13 02:01 6.9K 
[   ]intlchar.iscntrl.php2024-06-13 02:01 6.9K 
[   ]function.ctype-upper.php2024-06-13 02:01 6.9K 
[   ]mysqli.get-proto-info.php2024-06-13 02:01 6.9K 
[   ]ziparchive.setmtimeindex.php2024-06-13 02:01 6.9K 
[   ]function.openssl-public-decrypt.php2024-06-13 02:01 6.9K 
[   ]function.ibase-field-info.php2024-06-13 02:01 6.9K 
[   ]class.ui-controls-slider.php2024-06-13 02:01 6.9K 
[   ]mysql-xdevapi-result.getwarnings.php2024-06-13 02:01 6.9K 
[   ]reflectionclass.construct.php2024-06-13 02:01 6.8K 
[   ]memcached.setoptions.php2024-06-13 02:01 6.8K 
[   ]yaf-loader.registerlocalnamespace.php2024-06-13 02:01 6.8K 
[   ]function.array-replace.php2024-06-13 02:01 6.8K 
[   ]yar-client.setopt.php2024-06-13 02:01 6.8K 
[   ]function.imap-set-quota.php2024-06-13 02:01 6.8K 
[   ]intlchar.isjavaspacechar.php2024-06-13 02:01 6.8K 
[   ]function.mb-ord.php2024-06-13 02:01 6.8K 
[   ]mysql-xdevapi-collectionmodify.construct.php2024-06-13 02:01 6.8K 
[   ]domnodelist.item.php2024-06-13 02:01 6.8K 
[   ]ref.uodbc.php2024-06-13 02:01 6.8K 
[   ]pdo.errorinfo.php2024-06-13 02:01 6.8K 
[   ]ziparchive.setmtimename.php2024-06-13 02:01 6.8K 
[   ]mysql-xdevapi-sqlstatementresult.fetchone.php2024-06-13 02:01 6.8K 
[   ]function.imagetruecolortopalette.php2024-06-13 02:01 6.8K 
[   ]function.apcu-exists.php2024-06-13 02:01 6.8K 
[   ]function.mailparse-uudecode-all.php2024-06-13 02:01 6.8K 
[   ]soapheader.construct.php2024-06-13 02:01 6.8K 
[   ]function.imap-mail-move.php2024-06-13 02:01 6.8K 
[   ]function.mb-stristr.php2024-06-13 02:01 6.8K 
[   ]stomp.getreadtimeout.php2024-06-13 02:01 6.8K 
[   ]ds-map.remove.php2024-06-13 02:01 6.8K 
[   ]function.eio-write.php2024-06-13 02:01 6.8K 
[   ]function.array-merge-recursive.php2024-06-13 02:01 6.8K 
[   ]mysql-xdevapi-table.insert.php2024-06-13 02:01 6.8K 
[   ]function.get-class-methods.php2024-06-13 02:01 6.8K 
[   ]function.cubrid-new-glo.php2024-06-13 02:01 6.8K 
[   ]function.db2-conn-error.php2024-06-13 02:01 6.8K 
[   ]function.mcrypt-get-key-size.php2024-06-13 02:01 6.8K 
[   ]function.oci-num-fields.php2024-06-13 02:01 6.8K 
[   ]function.ftp-login.php2024-06-13 02:01 6.8K 
[   ]domdocument.prepend.php2024-06-13 02:01 6.8K 
[   ]function.enchant-broker-list-dicts.php2024-06-13 02:01 6.8K 
[   ]function.wincache-ucache-meminfo.php2024-06-13 02:01 6.8K 
[   ]function.sodium-crypto-generichash-init.php2024-06-13 02:01 6.8K 
[   ]intldatepatterngenerator.getbestpattern.php2024-06-13 02:01 6.8K 
[   ]control-structures.alternative-syntax.php2024-06-13 02:01 6.8K 
[   ]function.chgrp.php2024-06-13 02:01 6.8K 
[   ]function.openssl-pkey-export.php2024-06-13 02:01 6.8K 
[   ]class.svmmodel.php2024-06-13 02:01 6.8K 
[   ]rararchive.close.php2024-06-13 02:01 6.8K 
[   ]class.dotnet.php2024-06-13 02:01 6.8K 
[   ]intlchar.isdefined.php2024-06-13 02:01 6.8K 
[   ]timezones.america.php2024-06-13 02:01 6.8K 
[   ]function.ctype-punct.php2024-06-13 02:01 6.8K 
[   ]simplexmlelement.attributes.php2024-06-13 02:01 6.8K 
[   ]quickhashstringinthash.set.php2024-06-13 02:01 6.8K 
[   ]function.is-uploaded-file.php2024-06-13 02:01 6.8K 
[   ]zookeeper.getacl.php2024-06-13 02:01 6.8K 
[   ]intlchar.isblank.php2024-06-13 02:01 6.8K 
[   ]exception.getprevious.php2024-06-13 02:01 6.8K 
[   ]syncsharedmemory.read.php2024-06-13 02:01 6.8K 
[   ]intlcalendar.after.php2024-06-13 02:01 6.8K 
[   ]function.imagescale.php2024-06-13 02:01 6.8K 
[   ]function.cubrid-load-from-glo.php2024-06-13 02:01 6.8K 
[   ]imagickdraw.point.php2024-06-13 02:01 6.8K 
[   ]imagick.setcompressionquality.php2024-06-13 02:01 6.8K 
[   ]mysql-xdevapi-rowresult.fetchone.php2024-06-13 02:01 6.8K 
[   ]reflectiongenerator.gettrace.php2024-06-13 02:01 6.8K 
[   ]quickhashstringinthash.delete.php2024-06-13 02:01 6.8K 
[   ]function.pow.php2024-06-13 02:01 6.8K 
[   ]function.pg-untrace.php2024-06-13 02:01 6.8K 
[   ]eventbufferevent.construct.php2024-06-13 02:01 6.8K 
[   ]function.uopz-compose.php2024-06-13 02:01 6.8K 
[   ]function.sodium-crypto-generichash-final.php2024-06-13 02:01 6.8K 
[   ]function.pg-transaction-status.php2024-06-13 02:01 6.8K 
[   ]function.header-register-callback.php2024-06-13 02:01 6.8K 
[   ]function.ssh2-sftp-mkdir.php2024-06-13 02:01 6.8K 
[   ]function.header-remove.php2024-06-13 02:01 6.8K 
[   ]function.floatval.php2024-06-13 02:01 6.8K 
[   ]xsl.constants.php2024-06-13 02:01 6.8K 
[   ]intro.parallel.php2024-06-13 02:01 6.8K 
[   ]function.ctype-alnum.php2024-06-13 02:01 6.7K 
[   ]function.ob-get-clean.php2024-06-13 02:01 6.7K 
[   ]function.xml-set-start-namespace-decl-handler.php2024-06-13 02:01 6.7K 
[   ]zookeeperconfig.get.php2024-06-13 02:01 6.7K 
[   ]ziparchive.setcompressionindex.php2024-06-13 02:01 6.7K 
[   ]reflectionclass.innamespace.php2024-06-13 02:01 6.7K 
[   ]language.oop5.autoload.php2024-06-13 02:01 6.7K 
[   ]phar.offsetget.php2024-06-13 02:01 6.7K 
[   ]regexiterator.setflags.php2024-06-13 02:01 6.7K 
[   ]function.ctype-lower.php2024-06-13 02:01 6.7K 
[   ]imagick.colorizeimage.php2024-06-13 02:01 6.7K 
[   ]collator.getlocale.php2024-06-13 02:01 6.7K 
[   ]class.ui-draw-stroke.php2024-06-13 02:01 6.7K 
[   ]class.ui-controls-spin.php2024-06-13 02:01 6.7K 
[   ]domdocument.append.php2024-06-13 02:01 6.7K 
[   ]mongodb-driver-readconcern.bsonserialize.php2024-06-13 02:01 6.7K 
[   ]backedenum.tryfrom.php2024-06-13 02:01 6.7K 
[   ]reflectionclass.isiterable.php2024-06-13 02:01 6.7K 
[   ]ref.sockets.php2024-06-13 02:01 6.7K 
[   ]quickhashintstringhash.set.php2024-06-13 02:01 6.7K 
[   ]function.mysql-thread-id.php2024-06-13 02:01 6.7K 
[   ]threaded.merge.php2024-06-13 02:01 6.7K 
[   ]function.posix-access.php2024-06-13 02:01 6.7K 
[   ]function.rnp-op-verify.php2024-06-13 02:01 6.7K 
[   ]function.ftp-size.php2024-06-13 02:01 6.7K 
[   ]mbstring.constants.php2024-06-13 02:01 6.7K 
[   ]mysql-xdevapi-tabledelete.limit.php2024-06-13 02:01 6.7K 
[   ]mysql-xdevapi-schema.gettable.php2024-06-13 02:01 6.7K 
[   ]function.cubrid-errno.php2024-06-13 02:01 6.7K 
[   ]function.uopz-rename.php2024-06-13 02:01 6.7K 
[   ]reflectionmethod.getmodifiers.php2024-06-13 02:01 6.7K 
[   ]function.ftp-site.php2024-06-13 02:01 6.7K 
[   ]mysql-xdevapi-result.getgeneratedids.php2024-06-13 02:01 6.7K 
[   ]function.iterator-apply.php2024-06-13 02:01 6.7K 
[   ]function.imap-savebody.php2024-06-13 02:01 6.7K 
[   ]resourcebundle.geterrorcode.php2024-06-13 02:01 6.7K 
[   ]phardata.copy.php2024-06-13 02:01 6.7K 
[   ]mysql-xdevapi-tabledelete.bind.php2024-06-13 02:01 6.7K 
[   ]function.gzwrite.php2024-06-13 02:01 6.7K 
[   ]solrclient.commit.php2024-06-13 02:01 6.7K 
[   ]function.radius-put-vendor-string.php2024-06-13 02:01 6.7K 
[   ]function.xdiff-file-merge3.php2024-06-13 02:01 6.7K 
[   ]function.filetype.php2024-06-13 02:01 6.7K 
[   ]features.file-upload.multiple.php2024-06-13 02:01 6.7K 
[   ]function.ftp-exec.php2024-06-13 02:01 6.7K 
[   ]function.pcntl-signal-get-handler.php2024-06-13 02:01 6.7K 
[   ]function.iconv-strrpos.php2024-06-13 02:01 6.7K 
[   ]imagick.orderedposterizeimage.php2024-06-13 02:01 6.7K 
[   ]function.cubrid-save-to-glo.php2024-06-13 02:01 6.7K 
[   ]function.method-exists.php2024-06-13 02:01 6.7K 
[   ]numberformatter.geterrormessage.php2024-06-13 02:01 6.7K 
[   ]function.mb-strrichr.php2024-06-13 02:01 6.7K 
[   ]preface.php2024-06-13 02:01 6.7K 
[   ]class.stdclass.php2024-06-13 02:01 6.7K 
[   ]recursiveregexiterator.getchildren.php2024-06-13 02:01 6.7K 
[   ]function.mysql-get-proto-info.php2024-06-13 02:01 6.7K 
[   ]function.ibase-fetch-object.php2024-06-13 02:01 6.7K 
[   ]function.gzread.php2024-06-13 02:01 6.7K 
[   ]function.filemtime.php2024-06-13 02:01 6.7K 
[   ]function.geoip-db-get-all-info.php2024-06-13 02:01 6.7K 
[   ]imagick.motionblurimage.php2024-06-13 02:01 6.7K 
[   ]function.ctype-cntrl.php2024-06-13 02:01 6.7K 
[   ]function.pg-version.php2024-06-13 02:01 6.7K 
[   ]function.curl-version.php2024-06-13 02:01 6.7K 
[   ]class.mysql-xdevapi-sqlstatement.php2024-06-13 02:01 6.7K 
[   ]intlcalendar.setdatetime.php2024-06-13 02:01 6.7K 
[   ]splfileobject.fgetss.php2024-06-13 02:01 6.7K 
[   ]function.is-dir.php2024-06-13 02:01 6.7K 
[   ]function.db2-conn-errormsg.php2024-06-13 02:01 6.7K 
[   ]soapserver.addfunction.php2024-06-13 02:01 6.7K 
[   ]mysql-xdevapi-baseresult.getwarningscount.php2024-06-13 02:01 6.7K 
[   ]ds-sequence.insert.php2024-06-13 02:01 6.7K 
[   ]imagick.segmentimage.php2024-06-13 02:01 6.7K 
[   ]language.references.pass.php2024-06-13 02:01 6.7K 
[   ]function.mysql-escape-string.php2024-06-13 02:01 6.7K 
[   ]migration56.constants.php2024-06-13 02:01 6.7K 
[   ]function.debug-print-backtrace.php2024-06-13 02:01 6.7K 
[   ]function.yaz-ccl-parse.php2024-06-13 02:01 6.7K 
[   ]mysql-xdevapi-schema.dropcollection.php2024-06-13 02:01 6.7K 
[   ]function.pg-field-num.php2024-06-13 02:01 6.7K 
[   ]mysql-xdevapi-collectionfind.lockshared.php2024-06-13 02:01 6.6K 
[   ]arrayobject.offsetset.php2024-06-13 02:01 6.6K 
[   ]pdo.rollback.php2024-06-13 02:01 6.6K 
[   ]imagick.setsamplingfactors.php2024-06-13 02:01 6.6K 
[   ]function.mcrypt-get-block-size.php2024-06-13 02:01 6.6K 
[   ]oauthprovider.construct.php2024-06-13 02:01 6.6K 
[   ]splobjectstorage.offsetget.php2024-06-13 02:01 6.6K 
[   ]function.mb-strstr.php2024-06-13 02:01 6.6K 
[   ]function.gmp-div-qr.php2024-06-13 02:01 6.6K 
[   ]function.mb-strrchr.php2024-06-13 02:01 6.6K 
[   ]function.win32-start-service.php2024-06-13 02:01 6.6K 
[   ]syncreaderwriter.construct.php2024-06-13 02:01 6.6K 
[   ]function.win32-continue-service.php2024-06-13 02:01 6.6K 
[   ]memcached.fetch.php2024-06-13 02:01 6.6K 
[   ]function.rnp-ffi-set-pass-provider.php2024-06-13 02:01 6.6K 
[   ]function.jpeg2wbmp.php2024-06-13 02:01 6.6K 
[   ]intlchar.getpropertyenum.php2024-06-13 02:01 6.6K 
[   ]function.win32-pause-service.php2024-06-13 02:01 6.6K 
[   ]function.cubrid-get-query-timeout.php2024-06-13 02:01 6.6K 
[   ]function.strcasecmp.php2024-06-13 02:01 6.6K 
[   ]function.sqlsrv-client-info.php2024-06-13 02:01 6.6K 
[   ]function.posix-getgrgid.php2024-06-13 02:01 6.6K 
[   ]zookeeperconfig.set.php2024-06-13 02:01 6.6K 
[   ]function.wincache-scache-meminfo.php2024-06-13 02:01 6.6K 
[   ]function.end.php2024-06-13 02:01 6.6K 
[   ]class.ui-draw-brush-radialgradient.php2024-06-13 02:01 6.6K 
[   ]xsltprocessor.transformtoxml.php2024-06-13 02:01 6.6K 
[   ]language.enumerations.expressions.php2024-06-13 02:01 6.6K 
[   ]language.fibers.php2024-06-13 02:01 6.6K 
[   ]language.attributes.classes.php2024-06-13 02:01 6.6K 
[   ]function.posix-getgrnam.php2024-06-13 02:01 6.6K 
[   ]function.is-string.php2024-06-13 02:01 6.6K 
[   ]ref.posix.php2024-06-13 02:01 6.6K 
[   ]function.imageaffinematrixget.php2024-06-13 02:01 6.6K 
[   ]imagick.setimagebias.php2024-06-13 02:01 6.6K 
[   ]function.yaml-emit-file.php2024-06-13 02:01 6.6K 
[   ]swoole.configuration.php2024-06-13 02:01 6.6K 
[   ]imagickpixeliterator.getnextiteratorrow.php2024-06-13 02:01 6.6K 
[   ]intlchar.isjavaidstart.php2024-06-13 02:01 6.6K 
[   ]function.bzdecompress.php2024-06-13 02:01 6.6K 
[   ]function.apcu-cache-info.php2024-06-13 02:01 6.6K 
[   ]imagick.roundcorners.php2024-06-13 02:01 6.6K 
[   ]function.socket-set-nonblock.php2024-06-13 02:01 6.6K 
[   ]function.pg-lo-truncate.php2024-06-13 02:01 6.6K 
[   ]function.openssl-cms-encrypt.php2024-06-13 02:01 6.6K 
[   ]function.output-reset-rewrite-vars.php2024-06-13 02:01 6.6K 
[   ]imagick.statisticimage.php2024-06-13 02:01 6.6K 
[   ]function.png2wbmp.php2024-06-13 02:01 6.6K 
[   ]class.ui-controls-editablecombo.php2024-06-13 02:01 6.6K 
[   ]imagick.getpixelregioniterator.php2024-06-13 02:01 6.6K 
[   ]function.ini-set.php2024-06-13 02:01 6.6K 
[   ]function.odbc-prepare.php2024-06-13 02:01 6.6K 
[   ]class.norewinditerator.php2024-06-13 02:01 6.6K 
[   ]function.xml-set-processing-instruction-handler.php2024-06-13 02:01 6.6K 
[   ]intlchar.isspace.php2024-06-13 02:01 6.6K 
[   ]function.pspell-config-personal.php2024-06-13 02:01 6.6K 
[   ]phar.getmetadata.php2024-06-13 02:01 6.6K 
[   ]function.dbase-open.php2024-06-13 02:01 6.6K 
[   ]evchild.construct.php2024-06-13 02:01 6.6K 
[   ]function.ftp-connect.php2024-06-13 02:01 6.6K 
[   ]function.ctype-xdigit.php2024-06-13 02:01 6.6K 
[   ]yaf-view-simple.assign.php2024-06-13 02:01 6.6K 
[   ]ds-sequence.get.php2024-06-13 02:01 6.6K 
[   ]arrayobject.setflags.php2024-06-13 02:01 6.6K 
[   ]function.mb-convert-variables.php2024-06-13 02:01 6.6K 
[   ]phar.offsetunset.php2024-06-13 02:01 6.6K 
[   ]function.stream-filter-remove.php2024-06-13 02:01 6.6K 
[   ]function.libxml-use-internal-errors.php2024-06-13 02:01 6.6K 
[   ]function.xdiff-file-patch-binary.php2024-06-13 02:01 6.6K 
[   ]function.fgetc.php2024-06-13 02:01 6.6K 
[   ]function.lstat.php2024-06-13 02:01 6.6K 
[   ]function.is-int.php2024-06-13 02:01 6.6K 
[   ]imagick.unsharpmaskimage.php2024-06-13 02:01 6.6K 
[   ]phar.mapphar.php2024-06-13 02:01 6.6K 
[   ]function.hexdec.php2024-06-13 02:01 6.6K 
[   ]memcached.getbykey.php2024-06-13 02:01 6.6K 
[   ]imagick.appendimages.php2024-06-13 02:01 6.6K 
[   ]mysql-xdevapi-rowresult.fetchall.php2024-06-13 02:01 6.6K 
[   ]mongodb-driver-writeconcernerror.getinfo.php2024-06-13 02:01 6.6K 
[   ]function.imagefontheight.php2024-06-13 02:01 6.6K 
[   ]locale.getallvariants.php2024-06-13 02:01 6.6K 
[   ]domdocument.adoptnode.php2024-06-13 02:01 6.6K 
[   ]ds-vector.insert.php2024-06-13 02:01 6.6K 
[   ]imagick.quantizeimage.php2024-06-13 02:01 6.6K 
[   ]reflectionclass.export.php2024-06-13 02:01 6.6K 
[   ]function.ob-get-flush.php2024-06-13 02:01 6.6K 
[   ]odbc.installation.php2024-06-13 02:01 6.6K 
[   ]intlchar.charmirror.php2024-06-13 02:01 6.6K 
[   ]function.mb-substr.php2024-06-13 02:01 6.6K 
[   ]regexiterator.getmode.php2024-06-13 02:01 6.6K 
[   ]function.is-float.php2024-06-13 02:01 6.6K 
[   ]function.ibase-blob-get.php2024-06-13 02:01 6.6K 
[TXT]xmlreader.xml.php2024-06-13 02:01 6.6K 
[   ]phar.unlinkarchive.php2024-06-13 02:01 6.6K 
[   ]book.xmlwriter.php2024-06-13 02:01 6.6K 
[   ]yaf.tutorials.php2024-06-13 02:01 6.6K 
[   ]splfileinfo.getrealpath.php2024-06-13 02:01 6.6K 
[   ]function.pspell-config-mode.php2024-06-13 02:01 6.6K 
[   ]function.imagefontwidth.php2024-06-13 02:01 6.6K 
[   ]yaf-application.bootstrap.php2024-06-13 02:01 6.6K 
[   ]imagick.selectiveblurimage.php2024-06-13 02:01 6.6K 
[   ]function.win32-stop-service.php2024-06-13 02:01 6.6K 
[   ]function.ftp-cdup.php2024-06-13 02:01 6.6K 
[   ]collator.setattribute.php2024-06-13 02:01 6.6K 
[   ]domprocessinginstruction.construct.php2024-06-13 02:01 6.6K 
[   ]xmlreader.open.php2024-06-13 02:01 6.6K 
[   ]mysql-xdevapi-rowresult.getwarningscount.php2024-06-13 02:01 6.6K 
[   ]domparentnode.replacechildren.php2024-06-13 02:01 6.6K 
[   ]function.mb-stripos.php2024-06-13 02:01 6.6K 
[   ]function.imageaffinematrixconcat.php2024-06-13 02:01 6.6K 
[   ]filesystemiterator.setflags.php2024-06-13 02:01 6.6K 
[   ]function.fann-cascadetrain-on-data.php2024-06-13 02:01 6.5K 
[   ]resourcebundle.locales.php2024-06-13 02:01 6.5K 
[   ]function.imagecolorclosesthwb.php2024-06-13 02:01 6.5K 
[   ]splobjectstorage.key.php2024-06-13 02:01 6.5K 
[   ]function.mqseries-close.php2024-06-13 02:01 6.5K 
[   ]function.stream-socket-shutdown.php2024-06-13 02:01 6.5K 
[   ]function.ps-add-locallink.php2024-06-13 02:01 6.5K 
[   ]yaf-action-abstract.execute.php2024-06-13 02:01 6.5K 
[   ]function.mb-strpos.php2024-06-13 02:01 6.5K 
[   ]function.ftp-rmdir.php2024-06-13 02:01 6.5K 
[   ]ds-deque.insert.php2024-06-13 02:01 6.5K 
[   ]function.bzread.php2024-06-13 02:01 6.5K 
[   ]yaf-route-simple.assemble.php2024-06-13 02:01 6.5K 
[   ]function.restore-exception-handler.php2024-06-13 02:01 6.5K 
[   ]quickhashintstringhash.construct.php2024-06-13 02:01 6.5K 
[   ]intro.componere.php2024-06-13 02:01 6.5K 
[   ]intlcalendar.gettime.php2024-06-13 02:01 6.5K 
[   ]class.ui-controls-button.php2024-06-13 02:01 6.5K 
[   ]function.ldap-mod-del.php2024-06-13 02:01 6.5K 
[   ]mcrypt.constants.php2024-06-13 02:01 6.5K 
[   ]function.is-nan.php2024-06-13 02:01 6.5K 
[   ]domelement.construct.php2024-06-13 02:01 6.5K 
[   ]function.runkit7-method-rename.php2024-06-13 02:01 6.5K 
[   ]reflectionclass.getnamespacename.php2024-06-13 02:01 6.5K 
[   ]luasandbox.registerlibrary.php2024-06-13 02:01 6.5K 
[   ]domelement.insertadjacentelement.php2024-06-13 02:01 6.5K 
[   ]mysql-xdevapi-executable.execute.php2024-06-13 02:01 6.5K 
[   ]language.namespaces.rationale.php2024-06-13 02:01 6.5K 
[   ]yaf-route-regex.assemble.php2024-06-13 02:01 6.5K 
[   ]function.radius-get-tagged-attr-tag.php2024-06-13 02:01 6.5K 
[   ]class.generator.php2024-06-13 02:01 6.5K 
[   ]mysql-xdevapi-result.getwarningscount.php2024-06-13 02:01 6.5K 
[   ]error.getprevious.php2024-06-13 02:01 6.5K 
[   ]simplexmlelement.current.php2024-06-13 02:01 6.5K 
[   ]book.zookeeper.php2024-06-13 02:01 6.5K 
[   ]imagick.affinetransformimage.php2024-06-13 02:01 6.5K 
[   ]function.uopz-del-function.php2024-06-13 02:01 6.5K 
[   ]class.yar-concurrent-client.php2024-06-13 02:01 6.5K 
[   ]solrclient.getbyid.php2024-06-13 02:01 6.5K 
[   ]function.shmop-write.php2024-06-13 02:01 6.5K 
[   ]luasandbox.examples-basic.php2024-06-13 02:01 6.5K 
[   ]ds-vector.get.php2024-06-13 02:01 6.5K 
[   ]class.yar-client-exception.php2024-06-13 02:01 6.5K 
[   ]class.ui-controls-combo.php2024-06-13 02:01 6.5K 
[   ]appenditerator.getiteratorindex.php2024-06-13 02:01 6.5K 
[   ]splfileinfo.getextension.php2024-06-13 02:01 6.5K 
[   ]mysql-xdevapi-tableinsert.values.php2024-06-13 02:01 6.5K 
[   ]function.mb-language.php2024-06-13 02:01 6.5K 
[   ]splobjectstorage.offsetexists.php2024-06-13 02:01 6.5K 
[   ]imagick.vignetteimage.php2024-06-13 02:01 6.5K 
[   ]function.is-executable.php2024-06-13 02:01 6.5K 
[   ]gearmanclient.addtaskhighbackground.php2024-06-13 02:01 6.5K 
[   ]function.imap-mail-copy.php2024-06-13 02:01 6.5K 
[   ]function.strval.php2024-06-13 02:01 6.5K 
[   ]phardata.offsetset.php2024-06-13 02:01 6.5K 
[   ]function.mysql-num-fields.php2024-06-13 02:01 6.5K 
[   ]function.enchant-dict-describe.php2024-06-13 02:01 6.5K 
[   ]gearmanclient.addtasklowbackground.php2024-06-13 02:01 6.5K 
[   ]function.pspell-config-runtogether.php2024-06-13 02:01 6.5K 
[   ]function.image2wbmp.php2024-06-13 02:01 6.5K 
[   ]class.ui-controls-radio.php2024-06-13 02:01 6.5K 
[   ]reserved.classes.php2024-06-13 02:01 6.5K 
[   ]function.pg-unescape-bytea.php2024-06-13 02:01 6.5K 
[   ]function.openssl-pkey-get-private.php2024-06-13 02:01 6.5K 
[   ]function.snmp2-real-walk.php2024-06-13 02:01 6.5K 
[   ]reflectionclass.getshortname.php2024-06-13 02:01 6.5K 
[   ]yaf-route-simple.construct.php2024-06-13 02:01 6.5K 
[   ]function.imap-clearflag-full.php2024-06-13 02:01 6.5K 
[   ]sqlite3stmt.getsql.php2024-06-13 02:01 6.5K 
[   ]ds-deque.get.php2024-06-13 02:01 6.5K 
[   ]domdocument.load.php2024-06-13 02:01 6.5K 
[   ]mongodb-driver-writeresult.getserver.php2024-06-13 02:01 6.5K 
[   ]function.eio-sendfile.php2024-06-13 02:01 6.5K 
[   ]function.mysql-info.php2024-06-13 02:01 6.5K 
[   ]memcached.fetchall.php2024-06-13 02:01 6.5K 
[   ]regexp.reference.assertions.php2024-06-13 02:01 6.5K 
[   ]quickhashinthash.set.php2024-06-13 02:01 6.5K 
[   ]function.radius-get-tagged-attr-data.php2024-06-13 02:01 6.5K 
[   ]function.cubrid-db-name.php2024-06-13 02:01 6.5K 
[   ]arrayobject.getiteratorclass.php2024-06-13 02:01 6.5K 
[   ]reference.pcre.pattern.differences.php2024-06-13 02:01 6.5K 
[   ]function.sodium-crypto-generichash-update.php2024-06-13 02:01 6.5K 
[   ]function.gzseek.php2024-06-13 02:01 6.5K 
[   ]function.getservbyname.php2024-06-13 02:01 6.5K 
[   ]function.xattr-list.php2024-06-13 02:01 6.5K 
[   ]function.mb-eregi.php2024-06-13 02:01 6.5K 
[   ]class.yaf-route-simple.php2024-06-13 02:01 6.4K 
[   ]function.mb-strripos.php2024-06-13 02:01 6.4K 
[   ]phardata.construct.php2024-06-13 02:01 6.4K 
[   ]intlcalendar.setrepeatedwalltimeoption.php2024-06-13 02:01 6.4K 
[   ]ziparchive.setarchiveflag.php2024-06-13 02:01 6.4K 
[   ]mysql-xdevapi-collection.count.php2024-06-13 02:01 6.4K 
[   ]function.mcrypt-get-iv-size.php2024-06-13 02:01 6.4K 
[   ]class.ui-draw-brush-lineargradient.php2024-06-13 02:01 6.4K 
[   ]book.tidy.php2024-06-13 02:01 6.4K 
[   ]function.str-decrement.php2024-06-13 02:01 6.4K 
[   ]fileinfo.constants.php2024-06-13 02:01 6.4K 
[   ]mongodb-driver-manager.getreadpreference.php2024-06-13 02:01 6.4K 
[   ]syncsharedmemory.construct.php2024-06-13 02:01 6.4K 
[   ]function.pspell-add-to-personal.php2024-06-13 02:01 6.4K 
[   ]function.xdiff-file-bpatch.php2024-06-13 02:01 6.4K 
[   ]collator.sortwithsortkeys.php2024-06-13 02:01 6.4K 
[   ]function.xdiff-file-rabdiff.php2024-06-13 02:01 6.4K 
[   ]class.fannconnection.php2024-06-13 02:01 6.4K 
[   ]openssl.certparams.php2024-06-13 02:01 6.4K 
[   ]function.svn-add.php2024-06-13 02:01 6.4K 
[   ]memcache.delete.php2024-06-13 02:01 6.4K 
[   ]function.wincache-ucache-cas.php2024-06-13 02:01 6.4K 
[   ]function.ftruncate.php2024-06-13 02:01 6.4K 
[   ]function.imagecreatefromgd2.php2024-06-13 02:01 6.4K 
[   ]class.imagickkernel.php2024-06-13 02:01 6.4K 
[   ]ref.pdo-ibm.php2024-06-13 02:01 6.4K 
[   ]function.xml-set-end-namespace-decl-handler.php2024-06-13 02:01 6.4K 
[   ]tutorial.forms.php2024-06-13 02:01 6.4K 
[   ]function.pg-lo-read-all.php2024-06-13 02:01 6.4K 
[   ]function.sodium-crypto-pwhash-scryptsalsa208sha256.php2024-06-13 02:01 6.4K 
[   ]pdo.pgsqllobunlink.php2024-06-13 02:01 6.4K 
[   ]book.gmp.php2024-06-13 02:01 6.4K 
[   ]imagick.adaptivesharpenimage.php2024-06-13 02:01 6.4K 
[   ]ds-set.get.php2024-06-13 02:01 6.4K 
[   ]openssl.installation.php2024-06-13 02:01 6.4K 
[   ]class.ui-controls-colorbutton.php2024-06-13 02:01 6.4K 
[   ]sqlite3.prepare.php2024-06-13 02:01 6.4K 
[   ]solrquery.addfacetquery.php2024-06-13 02:01 6.4K 
[   ]function.mb-ereg.php2024-06-13 02:01 6.4K 
[   ]function.eio-futime.php2024-06-13 02:01 6.4K 
[   ]function.imap-mime-header-decode.php2024-06-13 02:01 6.4K 
[   ]mysql-xdevapi-collection.construct.php2024-06-13 02:01 6.4K 
[   ]imagick.raiseimage.php2024-06-13 02:01 6.4K 
[   ]function.is-readable.php2024-06-13 02:01 6.4K 
[   ]function.gmp-hamdist.php2024-06-13 02:01 6.4K 
[   ]function.php-ini-scanned-files.php2024-06-13 02:01 6.4K 
[   ]function.addslashes.php2024-06-13 02:01 6.4K 
[   ]intlchar.isidstart.php2024-06-13 02:01 6.4K 
[   ]language.constants.php2024-06-13 02:01 6.4K 
[   ]function.ldap-get-entries.php2024-06-13 02:01 6.4K 
[   ]phar.cancompress.php2024-06-13 02:01 6.4K 
[   ]function.simplexml-import-dom.php2024-06-13 02:01 6.4K 
[   ]syncsemaphore.construct.php2024-06-13 02:01 6.4K 
[   ]directoryiterator.key.php2024-06-13 02:01 6.4K 
[   ]memcache.examples-overview.php2024-06-13 02:01 6.4K 
[   ]function.bzwrite.php2024-06-13 02:01 6.4K 
[   ]ziparchive.statname.php2024-06-13 02:01 6.4K 
[   ]function.eio-fchown.php2024-06-13 02:01 6.4K 
[   ]mysqlnd.overview.php2024-06-13 02:01 6.4K 
[   ]function.mqseries-back.php2024-06-13 02:01 6.4K 
[   ]function.fann-train-on-data.php2024-06-13 02:01 6.4K 
[   ]class.yaf-route-map.php2024-06-13 02:01 6.4K 
[   ]function.pspell-new-config.php2024-06-13 02:01 6.4K 
[   ]mysql-xdevapi-tabledelete.execute.php2024-06-13 02:01 6.4K 
[   ]arrayobject.exchangearray.php2024-06-13 02:01 6.4K 
[   ]oldaliases.oci8.php2024-06-13 02:01 6.4K 
[   ]function.pg-host.php2024-06-13 02:01 6.4K 
[   ]function.dbase-pack.php2024-06-13 02:01 6.4K 
[   ]function.gmp-random.php2024-06-13 02:01 6.4K 
[   ]function.fann-set-activation-function.php2024-06-13 02:01 6.4K 
[   ]xsltprocessor.transformtouri.php2024-06-13 02:01 6.4K 
[   ]function.variant-xor.php2024-06-13 02:01 6.4K 
[   ]function.imap-fetchbody.php2024-06-13 02:01 6.4K 
[   ]eventhttp.addserveralias.php2024-06-13 02:01 6.4K 
[   ]domdocument.createprocessinginstruction.php2024-06-13 02:01 6.4K 
[   ]function.runkit7-method-remove.php2024-06-13 02:01 6.4K 
[   ]xsl.examples-errors.php2024-06-13 02:01 6.4K 
[   ]reflectionclass.getname.php2024-06-13 02:01 6.4K 
[   ]function.fann-train-on-file.php2024-06-13 02:01 6.4K 
[   ]function.radius-get-attr.php2024-06-13 02:01 6.4K 
[   ]function.wincache-ucache-dec.php2024-06-13 02:01 6.3K 
[   ]features.connection-handling.php2024-06-13 02:01 6.3K 
[   ]function.settype.php2024-06-13 02:01 6.3K 
[   ]function.inet-ntop.php2024-06-13 02:01 6.3K 
[   ]dba.example.php2024-06-13 02:01 6.3K 
[   ]mysql-xdevapi-schema.existsindatabase.php2024-06-13 02:01 6.3K 
[   ]mongodb-driver-writeconcernerror.getmessage.php2024-06-13 02:01 6.3K 
[   ]function.wincache-ucache-inc.php2024-06-13 02:01 6.3K 
[   ]function.snmprealwalk.php2024-06-13 02:01 6.3K 
[   ]function.setrawcookie.php2024-06-13 02:01 6.3K 
[   ]function.imap-fetchmime.php2024-06-13 02:01 6.3K 
[   ]domelement.insertadjacenttext.php2024-06-13 02:01 6.3K 
[   ]imagick.shearimage.php2024-06-13 02:01 6.3K 
[   ]splobjectstorage.offsetset.php2024-06-13 02:01 6.3K 
[   ]imagick.mergeimagelayers.php2024-06-13 02:01 6.3K 
[   ]recursivecallbackfilteriterator.haschildren.php2024-06-13 02:01 6.3K 
[   ]class.php-user-filter.php2024-06-13 02:01 6.3K 
[   ]yaml.configuration.php2024-06-13 02:01 6.3K 
[   ]migration56.deprecated.php2024-06-13 02:01 6.3K 
[   ]intlchar.isidignorable.php2024-06-13 02:01 6.3K 
[   ]intlchar.getbidipairedbracket.php2024-06-13 02:01 6.3K 
[   ]function.fdiv.php2024-06-13 02:01 6.3K 
[   ]ev.embeddablebackends.php2024-06-13 02:01 6.3K 
[   ]function.eio-chown.php2024-06-13 02:01 6.3K 
[   ]solrdismaxquery.removebigramphrasefield.php2024-06-13 02:01 6.3K 
[   ]imagick.randomthresholdimage.php2024-06-13 02:01 6.3K 
[   ]datetime.construct.php2024-06-13 02:01 6.3K 
[   ]mcrypt.ciphers.php2024-06-13 02:01 6.3K 
[   ]function.stream-context-set-options.php2024-06-13 02:01 6.3K 
[   ]function.enchant-dict-add.php2024-06-13 02:01 6.3K 
[   ]function.shm-attach.php2024-06-13 02:01 6.3K 
[   ]mysql-xdevapi-table.delete.php2024-06-13 02:01 6.3K 
[   ]class.zookeeperconfig.php2024-06-13 02:01 6.3K 
[   ]intlchar.getintpropertymaxvalue.php2024-06-13 02:01 6.3K 
[   ]history.php.related.php2024-06-13 02:01 6.3K 
[   ]function.radius-put-vendor-int.php2024-06-13 02:01 6.3K 
[   ]function.ibase-num-fields.php2024-06-13 02:01 6.3K 
[   ]ev.supportedbackends.php2024-06-13 02:01 6.3K 
[   ]function.mb-encoding-aliases.php2024-06-13 02:01 6.3K 
[   ]class.parallel-runtime.php2024-06-13 02:01 6.3K 
[   ]intlchar.getintpropertyminvalue.php2024-06-13 02:01 6.3K 
[   ]function.mqseries-cmit.php2024-06-13 02:01 6.3K 
[   ]function.timezone-name-from-abbr.php2024-06-13 02:01 6.3K 
[   ]function.yaml-parse-url.php2024-06-13 02:01 6.3K 
[   ]function.ini-restore.php2024-06-13 02:01 6.3K 
[   ]domelement.toggleattribute.php2024-06-13 02:01 6.3K 
[   ]function.xdiff-file-diff-binary.php2024-06-13 02:01 6.3K 
[   ]function.tidy-access-count.php2024-06-13 02:01 6.3K 
[   ]arrayiterator.uasort.php2024-06-13 02:01 6.3K 
[   ]xmlwriter.openuri.php2024-06-13 02:01 6.3K 
[   ]streamwrapper.stream-seek.php2024-06-13 02:01 6.3K 
[   ]function.rewind.php2024-06-13 02:01 6.3K 
[   ]function.variant-div.php2024-06-13 02:01 6.3K 
[   ]function.posix-pathconf.php2024-06-13 02:01 6.3K 
[   ]function.curl-reset.php2024-06-13 02:01 6.3K 
[   ]zlib.constants.php2024-06-13 02:01 6.3K 
[   ]pdo.errorcode.php2024-06-13 02:01 6.3K 
[   ]splobjectstorage.removeallexcept.php2024-06-13 02:01 6.3K 
[   ]class.reflectionattribute.php2024-06-13 02:01 6.3K 
[   ]function.cubrid-close.php2024-06-13 02:01 6.3K 
[   ]ziparchive.getarchiveflag.php2024-06-13 02:01 6.3K 
[   ]reflectionparameter.getclass.php2024-06-13 02:01 6.3K 
[   ]class.ui-controls-label.php2024-06-13 02:01 6.3K 
[   ]reflectionenum.getbackingtype.php2024-06-13 02:01 6.3K 
[   ]imagick.normalizeimage.php2024-06-13 02:01 6.3K 
[   ]class.sensitiveparameter.php2024-06-13 02:01 6.3K 
[   ]mysql-xdevapi-schema.getcollections.php2024-06-13 02:01 6.3K 
[   ]function.rawurlencode.php2024-06-13 02:01 6.3K 
[   ]function.mysql-client-encoding.php2024-06-13 02:01 6.3K 
[   ]function.cubrid-error.php2024-06-13 02:01 6.3K 
[   ]function.sodium-crypto-core-ristretto255-scalar-add.php2024-06-13 02:01 6.3K 
[   ]mysqli.real-query.php2024-06-13 02:01 6.3K 
[   ]function.openal-source-set.php2024-06-13 02:01 6.3K 
[   ]function.array-sum.php2024-06-13 02:01 6.3K 
[   ]reflectionfunctionabstract.getreturntype.php2024-06-13 02:01 6.3K 
[   ]book.mcrypt.php2024-06-13 02:01 6.3K 
[   ]intlcalendar.getlocale.php2024-06-13 02:01 6.3K 
[   ]wrappers.ftp.php2024-06-13 02:01 6.3K 
[   ]quickhashinthash.construct.php2024-06-13 02:01 6.3K 
[   ]function.sodium-crypto-core-ristretto255-scalar-sub.php2024-06-13 02:01 6.3K 
[   ]class.ui-size.php2024-06-13 02:01 6.3K 
[   ]function.xattr-remove.php2024-06-13 02:01 6.3K 
[   ]class.random-engine-xoshiro256starstar.php2024-06-13 02:01 6.3K 
[   ]splobjectstorage.attach.php2024-06-13 02:01 6.3K 
[   ]function.set-include-path.php2024-06-13 02:01 6.3K 
[   ]xmlwriter.writeelement.php2024-06-13 02:01 6.3K 
[   ]function.curl-copy-handle.php2024-06-13 02:01 6.3K 
[   ]mongodb-driver-writeconcernerror.getcode.php2024-06-13 02:01 6.3K 
[   ]function.gmp-sqrtrem.php2024-06-13 02:01 6.3K 
[   ]directoryiterator.getbasename.php2024-06-13 02:01 6.3K 
[   ]function.cubrid-get-class-name.php2024-06-13 02:01 6.3K 
[   ]functions.returning-values.php2024-06-13 02:01 6.3K 
[   ]function.is-countable.php2024-06-13 02:01 6.3K 
[   ]function.urldecode.php2024-06-13 02:01 6.2K 
[   ]function.cal-info.php2024-06-13 02:01 6.2K 
[   ]class.mongodb-driver-monitoring-commandsubscriber.php2024-06-13 02:01 6.2K 
[   ]function.ldap-escape.php2024-06-13 02:01 6.2K 
[   ]gnupg.examples-clearsign.php2024-06-13 02:01 6.2K 
[   ]yaf-loader.registernamespace.php2024-06-13 02:01 6.2K 
[   ]function.sqlsrv-has-rows.php2024-06-13 02:01 6.2K 
[   ]function.function-exists.php2024-06-13 02:01 6.2K 
[   ]posix.constants.pathconf.php2024-06-13 02:01 6.2K 
[   ]function.highlight-file.php2024-06-13 02:01 6.2K 
[   ]book.soap.php2024-06-13 02:01 6.2K 
[TXT]datetime.sub.php2024-06-13 02:01 6.2K 
[   ]class.iteratoraggregate.php2024-06-13 02:01 6.2K 
[   ]class.reflectiongenerator.php2024-06-13 02:01 6.2K 
[   ]closure.call.php2024-06-13 02:01 6.2K 
[   ]function.svn-update.php2024-06-13 02:01 6.2K 
[   ]function.mb-get-info.php2024-06-13 02:01 6.2K 
[   ]imagick.recolorimage.php2024-06-13 02:01 6.2K 
[   ]xsltprocessor.setprofiling.php2024-06-13 02:01 6.2K 
[   ]quickhashintset.construct.php2024-06-13 02:01 6.2K 
[   ]function.imagecreatefromxpm.php2024-06-13 02:01 6.2K 
[   ]function.mqseries-put1.php2024-06-13 02:01 6.2K 
[   ]random-randomizer.getbytes.php2024-06-13 02:01 6.2K 
[   ]tidynode.isphp.php2024-06-13 02:01 6.2K 
[   ]function.curl-strerror.php2024-06-13 02:01 6.2K 
[   ]phar.delmetadata.php2024-06-13 02:01 6.2K 
[   ]function.stream-bucket-prepend.php2024-06-13 02:01 6.2K 
[   ]imagick.waveimage.php2024-06-13 02:01 6.2K 
[   ]function.gnupg-sign.php2024-06-13 02:01 6.2K 
[   ]function.class-uses.php2024-06-13 02:01 6.2K 
[   ]pool.submitTo.php2024-06-13 02:01 6.2K 
[   ]function.get-called-class.php2024-06-13 02:01 6.2K 
[   ]compersisthelper.savetofile.php2024-06-13 02:01 6.2K 
[   ]intlchar.isprint.php2024-06-13 02:01 6.2K 
[   ]geoip.constants.php2024-06-13 02:01 6.2K 
[   ]arrayiterator.uksort.php2024-06-13 02:01 6.2K 
[   ]function.xmlrpc-get-type.php2024-06-13 02:01 6.2K 
[   ]function.ldap-rename-ext.php2024-06-13 02:01 6.2K 
[   ]class.mysql-xdevapi-tableupdate.php2024-06-13 02:01 6.2K 
[   ]function.ftp-delete.php2024-06-13 02:01 6.2K 
[   ]phar.configuration.php2024-06-13 02:01 6.2K 
[   ]function.session-id.php2024-06-13 02:01 6.2K 
[   ]splobjectstorage.rewind.php2024-06-13 02:01 6.2K 
[   ]phar.construct.php2024-06-13 02:01 6.2K 
[   ]memcached.setmulti.php2024-06-13 02:01 6.2K 
[   ]imagickpixeliterator.clear.php2024-06-13 02:01 6.2K 
[   ]function.strcmp.php2024-06-13 02:01 6.2K 
[   ]function.sodium-crypto-secretbox-keygen.php2024-06-13 02:01 6.2K 
[   ]function.array-reverse.php2024-06-13 02:01 6.2K 
[   ]domdocument.loadxml.php2024-06-13 02:01 6.2K 
[   ]reflectionproperty.setaccessible.php2024-06-13 02:01 6.2K 
[   ]class.iteratoriterator.php2024-06-13 02:01 6.2K 
[   ]memcache.pconnect.php2024-06-13 02:01 6.2K 
[   ]mysql-xdevapi-table.existsindatabase.php2024-06-13 02:01 6.2K 
[   ]ds-map.map.php2024-06-13 02:01 6.2K 
[   ]mysql-xdevapi-tableinsert.execute.php2024-06-13 02:01 6.2K 
[   ]function.get-object-vars.php2024-06-13 02:01 6.2K 
[   ]class.ui-point.php2024-06-13 02:01 6.2K 
[   ]function.is-finite.php2024-06-13 02:01 6.2K 
[   ]phar.getstub.php2024-06-13 02:01 6.2K 
[   ]function.pg-ping.php2024-06-13 02:01 6.2K 
[   ]function.socket-set-block.php2024-06-13 02:01 6.2K 
[   ]tidynode.istext.php2024-06-13 02:01 6.2K 
[   ]tidynode.iscomment.php2024-06-13 02:01 6.2K 
[   ]tidynode.isasp.php2024-06-13 02:01 6.2K 
[   ]solrdocument.toarray.php2024-06-13 02:01 6.2K 
[   ]splfixedarray.fromarray.php2024-06-13 02:01 6.2K 
[   ]imagick.newimage.php2024-06-13 02:01 6.2K 
[   ]function.cubrid-send-glo.php2024-06-13 02:01 6.2K 
[   ]reflectionclass.hasproperty.php2024-06-13 02:01 6.2K 
[   ]function.inflate-add.php2024-06-13 02:01 6.2K 
[   ]function.bcsqrt.php2024-06-13 02:01 6.2K 
[   ]class.mongodb-driver-cursorinterface.php2024-06-13 02:01 6.2K 
[   ]function.ucfirst.php2024-06-13 02:01 6.2K 
[   ]function.imagecreatefromgd.php2024-06-13 02:01 6.2K 
[   ]language.attributes.syntax.php2024-06-13 02:01 6.2K 
[   ]function.cubrid-close-request.php2024-06-13 02:01 6.2K 
[   ]class.ui-menu.php2024-06-13 02:01 6.2K 
[   ]reflectionclassconstant.isenumcase.php2024-06-13 02:01 6.2K 
[   ]phar.offsetexists.php2024-06-13 02:01 6.2K 
[   ]function.mqseries-set.php2024-06-13 02:01 6.1K 
[   ]tidynode.isjste.php2024-06-13 02:01 6.1K 
[   ]function.cubrid-close-prepare.php2024-06-13 02:01 6.1K 
[   ]function.get-defined-vars.php2024-06-13 02:01 6.1K 
[   ]function.eio-readahead.php2024-06-13 02:01 6.1K 
[   ]arrayobject.construct.php2024-06-13 02:01 6.1K 
[   ]function.imageavif.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-table.update.php2024-06-13 02:01 6.1K 
[   ]pharfileinfo.chmod.php2024-06-13 02:01 6.1K 
[   ]imagick.setiteratorindex.php2024-06-13 02:01 6.1K 
[   ]function.ldap-bind-ext.php2024-06-13 02:01 6.1K 
[   ]backedenum.from.php2024-06-13 02:01 6.1K 
[   ]function.str-increment.php2024-06-13 02:01 6.1K 
[   ]solrdismaxquery.addtrigramphrasefield.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-tableselect.orderby.php2024-06-13 02:01 6.1K 
[   ]rrd.examples-oop.php2024-06-13 02:01 6.1K 
[   ]function.mongodb.bson-fromphp.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-collection.existsindatabase.php2024-06-13 02:01 6.1K 
[   ]book.ftp.php2024-06-13 02:01 6.1K 
[   ]function.gzgetss.php2024-06-13 02:01 6.1K 
[   ]function.eio-chmod.php2024-06-13 02:01 6.1K 
[   ]mongodb-driver-writeerror.getindex.php2024-06-13 02:01 6.1K 
[   ]function.stream-context-set-default.php2024-06-13 02:01 6.1K 
[   ]intlchar.isdigit.php2024-06-13 02:01 6.1K 
[   ]intlchar.isbase.php2024-06-13 02:01 6.1K 
[   ]imagick.gaussianblurimage.php2024-06-13 02:01 6.1K 
[   ]function.odbc-data-source.php2024-06-13 02:01 6.1K 
[   ]reflectionproperty.ispromoted.php2024-06-13 02:01 6.1K 
[   ]function.ftp-get-option.php2024-06-13 02:01 6.1K 
[   ]function.eio-utime.php2024-06-13 02:01 6.1K 
[   ]class.finfo.php2024-06-13 02:01 6.1K 
[   ]ziparchive.getfromindex.php2024-06-13 02:01 6.1K 
[   ]imagick.adaptivethresholdimage.php2024-06-13 02:01 6.1K 
[   ]function.pg-tty.php2024-06-13 02:01 6.1K 
[   ]function.mb-substr-count.php2024-06-13 02:01 6.1K 
[   ]errorexception.construct.php2024-06-13 02:01 6.1K 
[   ]solrdismaxquery.removetrigramphrasefield.php2024-06-13 02:01 6.1K 
[   ]locale.acceptfromhttp.php2024-06-13 02:01 6.1K 
[   ]regexp.reference.back-references.php2024-06-13 02:01 6.1K 
[   ]example.xml-structure.php2024-06-13 02:01 6.1K 
[   ]reflectionfunctionabstract.hasreturntype.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-tabledelete.construct.php2024-06-13 02:01 6.1K 
[   ]function.wincache-ucache-exists.php2024-06-13 02:01 6.1K 
[   ]simplexmlelement.getchildren.php2024-06-13 02:01 6.1K 
[   ]pdostatement.errorinfo.php2024-06-13 02:01 6.1K 
[   ]function.uopz-get-property.php2024-06-13 02:01 6.1K 
[   ]function.eio-ftruncate.php2024-06-13 02:01 6.1K 
[   ]yar.constants.php2024-06-13 02:01 6.1K 
[   ]function.str-shuffle.php2024-06-13 02:01 6.1K 
[   ]function.fstat.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-rowresult.getcolumnnames.php2024-06-13 02:01 6.1K 
[   ]function.radius-cvt-addr.php2024-06-13 02:01 6.1K 
[   ]function.preg-grep.php2024-06-13 02:01 6.1K 
[   ]function.gnupg-decrypt.php2024-06-13 02:01 6.1K 
[   ]worker.collect.php2024-06-13 02:01 6.1K 
[   ]solrdismaxquery.addbigramphrasefield.php2024-06-13 02:01 6.1K 
[   ]intlcalendar.geterrormessage.php2024-06-13 02:01 6.1K 
[   ]function.svn-import.php2024-06-13 02:01 6.1K 
[   ]function.mb-ereg-search-init.php2024-06-13 02:01 6.1K 
[   ]function.eio-fchmod.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-rowresult.getcolumncount.php2024-06-13 02:01 6.1K 
[   ]migration82.deprecated.php2024-06-13 02:01 6.1K 
[   ]function.eio-truncate.php2024-06-13 02:01 6.1K 
[   ]datetime.configuration.php2024-06-13 02:01 6.1K 
[   ]class.random-engine-pcgoneseq128xslrr64.php2024-06-13 02:01 6.1K 
[   ]solrclient.deletebyquery.php2024-06-13 02:01 6.1K 
[   ]mysqli.installation.php2024-06-13 02:01 6.1K 
[   ]ds-sequence.set.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-table.isview.php2024-06-13 02:01 6.1K 
[   ]function.ftell.php2024-06-13 02:01 6.1K 
[   ]intlchar.isgraph.php2024-06-13 02:01 6.1K 
[   ]function.openssl-x509-check-private-key.php2024-06-13 02:01 6.1K 
[   ]function.gzcompress.php2024-06-13 02:01 6.1K 
[   ]function.unlink.php2024-06-13 02:01 6.1K 
[   ]mongodb-bson-persistable.bsonserialize.php2024-06-13 02:01 6.1K 
[   ]mysql-xdevapi-tableselect.where.php2024-06-13 02:01 6.1K 
[   ]vtiful-kernel-format.underline.php2024-06-13 02:01 6.1K 
[   ]memcache.getserverstatus.php2024-06-13 02:01 6.1K 
[   ]install.unix.lighttpd-14.php2024-06-13 02:01 6.1K 
[   ]function.gzgets.php2024-06-13 02:01 6.1K 
[   ]ziparchive.getstreamname.php2024-06-13 02:01 6.1K 
[   ]streamwrapper.stream-read.php2024-06-13 02:01 6.1K 
[   ]migration72.other-changes.php2024-06-13 02:01 6.1K 
[   ]function.cal-to-jd.php2024-06-13 02:01 6.1K 
[   ]domelement.setattribute.php2024-06-13 02:01 6.1K 
[   ]function.pg-num-fields.php2024-06-13 02:01 6.1K 
[   ]vtiful-kernel-excel.setColumn.php2024-06-13 02:01 6.1K 
[   ]function.gmp-div-r.php2024-06-13 02:01 6.1K 
[   ]function.imap-lsub.php2024-06-13 02:01 6.1K 
[   ]zookeeper.getchildren.php2024-06-13 02:01 6.1K 
[   ]function.rnp-op-sign.php2024-06-13 02:01 6.1K 
[   ]quickhashintstringhash.delete.php2024-06-13 02:01 6.1K 
[   ]function.sqlsrv-server-info.php2024-06-13 02:01 6.1K 
[   ]imagick.haldclutimage.php2024-06-13 02:01 6.1K 
[   ]function.sodium-crypto-core-ristretto255-sub.php2024-06-13 02:01 6.1K 
[   ]function.strtolower.php2024-06-13 02:01 6.1K 
[   ]domdocument.createentityreference.php2024-06-13 02:01 6.1K 
[   ]splobjectstorage.next.php2024-06-13 02:01 6.0K 
[   ]class.mongodb-bson-persistable.php2024-06-13 02:01 6.0K 
[   ]luasandbox.setcpulimit.php2024-06-13 02:01 6.0K 
[   ]book.componere.php2024-06-13 02:01 6.0K 
[   ]function.strtoupper.php2024-06-13 02:01 6.0K 
[   ]function.imap-check.php2024-06-13 02:01 6.0K 
[   ]imagick.setimagedelay.php2024-06-13 02:01 6.0K 
[   ]function.sodium-crypto-box-seal-open.php2024-06-13 02:01 6.0K 
[   ]function.pg-num-rows.php2024-06-13 02:01 6.0K 
[   ]tidy.diagnose.php2024-06-13 02:01 6.0K 
[   ]function.pcntl-getpriority.php2024-06-13 02:01 6.0K 
[   ]function.cubrid-fetch-lengths.php2024-06-13 02:01 6.0K 
[   ]mysql-xdevapi-result.getaffecteditemscount.php2024-06-13 02:01 6.0K 
[   ]spltempfileobject.construct.php2024-06-13 02:01 6.0K 
[   ]reflectionmethod.setaccessible.php2024-06-13 02:01 6.0K 
[   ]mysql-xdevapi-tableselect.bind.php2024-06-13 02:01 6.0K 
[   ]language.enumerations.object-differences.inheritance.php2024-06-13 02:01 6.0K 
[   ]function.copy.php2024-06-13 02:01 6.0K 
[   ]function.snmp2-getnext.php2024-06-13 02:01 6.0K 
[   ]function.headers-list.php2024-06-13 02:01 6.0K 
[   ]datetimezone.listabbreviations.php2024-06-13 02:01 6.0K 
[   ]function.pcntl-sigprocmask.php2024-06-13 02:01 6.0K 
[   ]reflectionmethod.getprototype.php2024-06-13 02:01 6.0K 
[   ]regexiterator.setpregflags.php2024-06-13 02:01 6.0K 
[   ]solrclient.request.php2024-06-13 02:01 6.0K 
[TXT]mongodb.installation.manual.php2024-06-13 02:01 6.0K 
[   ]function.fann-set-activation-steepness.php2024-06-13 02:01 6.0K 
[   ]language.namespaces.fallback.php2024-06-13 02:01 6.0K 
[   ]function.rename.php2024-06-13 02:01 6.0K 
[   ]eventbufferevent.about.callbacks.php2024-06-13 02:01 6.0K 
[   ]imagick.cropimage.php2024-06-13 02:01 6.0K 
[   ]class.ffi-cdata.php2024-06-13 02:01 6.0K 
[   ]yaf-response-abstract.setbody.php2024-06-13 02:01 6.0K 
[   ]session.idpassing.php2024-06-13 02:01 6.0K 
[   ]function.ibase-service-detach.php2024-06-13 02:01 6.0K 
[   ]solrquery.setgroupcachepercent.php2024-06-13 02:01 6.0K 
[   ]function.is-file.php2024-06-13 02:01 6.0K 
[   ]function.ibase-trans.php2024-06-13 02:01 6.0K 
[   ]features.commandline.io-streams.php2024-06-13 02:01 6.0K 
[   ]function.getmxrr.php2024-06-13 02:01 6.0K 
[   ]ziparchive.getstreamindex.php2024-06-13 02:01 6.0K 
[   ]misc.configuration.php2024-06-13 02:01 6.0K 
[   ]function.link.php2024-06-13 02:01 6.0K 
[   ]solrdismaxquery.removeboostquery.php2024-06-13 02:01 6.0K 
[   ]solrdismaxquery.addphrasefield.php2024-06-13 02:01 6.0K 
[   ]function.gnupg-encrypt.php2024-06-13 02:01 6.0K 
[   ]function.pspell-save-wordlist.php2024-06-13 02:01 6.0K 
[   ]function.sodium-crypto-core-ristretto255-add.php2024-06-13 02:01 6.0K 
[   ]function.rpmdbsearch.php2024-06-13 02:01 6.0K 
[   ]ziparchive.registercancelcallback.php2024-06-13 02:01 6.0K 
[   ]solrquery.addfilterquery.php2024-06-13 02:01 6.0K 
[   ]random-randomizer.getint.php2024-06-13 02:01 6.0K 
[   ]imagick.textureimage.php2024-06-13 02:01 6.0K 
[   ]directoryiterator.getextension.php2024-06-13 02:01 6.0K 
[   ]zookeeper.delete.php2024-06-13 02:01 6.0K 
[   ]function.imagegetclip.php2024-06-13 02:01 6.0K 
[   ]vtiful-kernel-excel.setRow.php2024-06-13 02:01 6.0K 
[   ]regexp.reference.onlyonce.php2024-06-13 02:01 6.0K 
[   ]function.gmp-random-bits.php2024-06-13 02:01 6.0K 
[   ]reflectionfunction.invoke.php2024-06-13 02:01 6.0K 
[   ]function.xattr-get.php2024-06-13 02:01 6.0K 
[   ]phar.loadphar.php2024-06-13 02:01 6.0K 
[   ]function.is-null.php2024-06-13 02:01 6.0K 
[   ]function.imagegammacorrect.php2024-06-13 02:01 6.0K 
[   ]function.imap-getacl.php2024-06-13 02:01 6.0K 
[   ]function.md5.php2024-06-13 02:01 6.0K 
[   ]arrayobject.getflags.php2024-06-13 02:01 6.0K 
[   ]install.unix.openbsd.php2024-06-13 02:01 6.0K 
[   ]function.lcfirst.php2024-06-13 02:01 6.0K 
[   ]splobjectstorage.offsetunset.php2024-06-13 02:01 6.0K 
[   ]function.ps-set-info.php2024-06-13 02:01 6.0K 
[   ]yaml.callbacks.emit.php2024-06-13 02:01 6.0K 
[   ]mysqli.get-client-info.php2024-06-13 02:01 6.0K 
[   ]function.ftp-close.php2024-06-13 02:01 6.0K 
[   ]function.ssh2-scp-send.php2024-06-13 02:01 6.0K 
[   ]reflectionenum.isbacked.php2024-06-13 02:01 6.0K 
[   ]book.network.php2024-06-13 02:01 6.0K 
[   ]function.octdec.php2024-06-13 02:01 6.0K 
[   ]phar.mungserver.php2024-06-13 02:01 6.0K 
[   ]function.php-sapi-name.php2024-06-13 02:01 6.0K 
[   ]imagickpixel.getcolorvaluequantum.php2024-06-13 02:01 6.0K 
[   ]ds-vector.set.php2024-06-13 02:01 6.0K 
[   ]phardata.delmetadata.php2024-06-13 02:01 6.0K 
[   ]locale.getprimarylanguage.php2024-06-13 02:01 6.0K 
[   ]imagick.getiteratorindex.php2024-06-13 02:01 6.0K 
[   ]function.lchgrp.php2024-06-13 02:01 6.0K 
[   ]function.yaml-parse-file.php2024-06-13 02:01 6.0K 
[   ]function.ldap-parse-exop.php2024-06-13 02:01 6.0K 
[   ]function.mysql-set-charset.php2024-06-13 02:01 6.0K 
[   ]function.cubrid-ping.php2024-06-13 02:01 6.0K 
[   ]oci8.datatypes.php2024-06-13 02:01 6.0K 
[   ]language.oop5.final.php2024-06-13 02:01 6.0K 
[   ]reflectionparameter.isarray.php2024-06-13 02:01 6.0K 
[   ]mysql-xdevapi-session.setsavepoint.php2024-06-13 02:01 6.0K 
[   ]reflectionclass.newinstanceargs.php2024-06-13 02:01 6.0K 
[   ]function.curl-close.php2024-06-13 02:01 6.0K 
[   ]phar.count.php2024-06-13 02:01 6.0K 
[   ]directoryiterator.current.php2024-06-13 02:01 6.0K 
[   ]memcached.decrementbykey.php2024-06-13 02:01 6.0K 
[   ]function.ftp-pwd.php2024-06-13 02:01 6.0K 
[   ]collator.getattribute.php2024-06-13 02:01 6.0K 
[   ]ref.gnupg.php2024-06-13 02:01 6.0K 
[   ]ref.gmp.php2024-06-13 02:01 6.0K 
[   ]ds-deque.set.php2024-06-13 02:01 6.0K 
[   ]yaf-application.getlasterrorno.php2024-06-13 02:01 6.0K 
[   ]seaslog.flushbuffer.php2024-06-13 02:01 6.0K 
[   ]function.curl-errno.php2024-06-13 02:01 6.0K 
[   ]function.ps-setcolor.php2024-06-13 02:01 6.0K 
[   ]function.fdf-get-attachment.php2024-06-13 02:01 6.0K 
[   ]function.enchant-broker-describe.php2024-06-13 02:01 6.0K 
[   ]splfileinfo.setinfoclass.php2024-06-13 02:01 6.0K 
[   ]function.dbase-numfields.php2024-06-13 02:01 6.0K 
[   ]memcached.casbykey.php2024-06-13 02:01 6.0K 
[   ]intlchar.isualphabetic.php2024-06-13 02:01 6.0K 
[   ]function.func-num-args.php2024-06-13 02:01 6.0K 
[   ]splobjectstorage.count.php2024-06-13 02:01 6.0K 
[   ]function.mcrypt-decrypt.php2024-06-13 02:01 6.0K 
[   ]function.socket-addrinfo-lookup.php2024-06-13 02:01 5.9K 
[   ]class.soapheader.php2024-06-13 02:01 5.9K 
[   ]splobjectstorage.removeall.php2024-06-13 02:01 5.9K 
[   ]eventconfig.requirefeatures.php2024-06-13 02:01 5.9K 
[   ]reflectionreference.getid.php2024-06-13 02:01 5.9K 
[   ]class.yaf-view-interface.php2024-06-13 02:01 5.9K 
[   ]function.mb-ereg-search-pos.php2024-06-13 02:01 5.9K 
[   ]eventlistener.setcallback.php2024-06-13 02:01 5.9K 
[   ]function.pg-port.php2024-06-13 02:01 5.9K 
[   ]reflectionparameter.iscallable.php2024-06-13 02:01 5.9K 
[   ]domdocument.validate.php2024-06-13 02:01 5.9K 
[   ]solrdismaxquery.removephrasefield.php2024-06-13 02:01 5.9K 
[   ]intlchar.isalnum.php2024-06-13 02:01 5.9K 
[   ]function.ssh2-sftp-chmod.php2024-06-13 02:01 5.9K 
[   ]function.ldap-mod_replace-ext.php2024-06-13 02:01 5.9K 
[   ]class.mongodb-bson-dbpointer.php2024-06-13 02:01 5.9K 
[   ]mongodb-driver-writeconcern.getjournal.php2024-06-13 02:01 5.9K 
[   ]memcache.setcompressthreshold.php2024-06-13 02:01 5.9K 
[   ]imagick.fximage.php2024-06-13 02:01 5.9K 
[   ]event.constructing.signal.events.php2024-06-13 02:01 5.9K 
[   ]quickhashinthash.delete.php2024-06-13 02:01 5.9K 
[   ]imagick.borderimage.php2024-06-13 02:01 5.9K 
[   ]locale.getregion.php2024-06-13 02:01 5.9K 
[   ]imagick.clutimage.php2024-06-13 02:01 5.9K 
[   ]function.time-sleep-until.php2024-06-13 02:01 5.9K 
[   ]function.ldap-first-entry.php2024-06-13 02:01 5.9K 
[   ]book.rnp.php2024-06-13 02:01 5.9K 
[   ]function.oci-set-call-timout.php2024-06-13 02:01 5.9K 
[   ]function.zip-entry-open.php2024-06-13 02:01 5.9K 
[   ]function.uopz-delete.php2024-06-13 02:01 5.9K 
[   ]function.gmp-testbit.php2024-06-13 02:01 5.9K 
[   ]imagick.transformimage.php2024-06-13 02:01 5.9K 
[   ]function.snmpgetnext.php2024-06-13 02:01 5.9K 
[   ]ref.com.php2024-06-13 02:01 5.9K 
[   ]domdocument.getelementsbytagname.php2024-06-13 02:01 5.9K 
[   ]reflectionenum.getcase.php2024-06-13 02:01 5.9K 
[   ]mysqlinfo.terminology.php2024-06-13 02:01 5.9K 
[   ]function.cubrid-current-oid.php2024-06-13 02:01 5.9K 
[   ]datetimeimmutable.settimezone.php2024-06-13 02:01 5.9K 
[   ]function.win32-set-service-exit-mode.php2024-06-13 02:01 5.9K 
[   ]function.fdatasync.php2024-06-13 02:01 5.9K 
[   ]function.is-writable.php2024-06-13 02:01 5.9K 
[   ]intro.phpdbg.php2024-06-13 02:01 5.9K 
[   ]function.gmp-import.php2024-06-13 02:01 5.9K 
[   ]function.ldap-next-entry.php2024-06-13 02:01 5.9K 
[   ]class.domimplementation.php2024-06-13 02:01 5.9K 
[   ]class.yaf-registry.php2024-06-13 02:01 5.9K 
[   ]class.ui-draw-text-font-descriptor.php2024-06-13 02:01 5.9K 
[   ]language.operators.errorcontrol.php2024-06-13 02:01 5.9K 
[   ]class.mongodb-bson-undefined.php2024-06-13 02:01 5.9K 
[   ]solrdismaxquery.addboostquery.php2024-06-13 02:01 5.9K 
[   ]function.apcu-delete.php2024-06-13 02:01 5.9K 
[   ]mongodb-driver-manager.getwriteconcern.php2024-06-13 02:01 5.9K 
[   ]function.get-included-files.php2024-06-13 02:01 5.9K 
[   ]function.wddx-serialize-vars.php2024-06-13 02:01 5.9K 
[   ]phar.setalias.php2024-06-13 02:01 5.9K 
[   ]mysql-xdevapi-tableinsert.construct.php2024-06-13 02:01 5.9K 
[   ]memcached.incrementbykey.php2024-06-13 02:01 5.9K 
[   ]function.recode-file.php2024-06-13 02:01 5.9K 
[   ]function.stats-cdf-noncentral-f.php2024-06-13 02:01 5.9K 
[   ]solrdismaxquery.removeuserfield.php2024-06-13 02:01 5.9K 
[   ]intlchar.ispunct.php2024-06-13 02:01 5.9K 
[   ]luasandbox.getprofilerfunctionreport.php2024-06-13 02:01 5.9K 
[   ]function.cubrid-num-cols.php2024-06-13 02:01 5.9K 
[   ]function.curl-error.php2024-06-13 02:01 5.9K 
[   ]function.mqseries-conn.php2024-06-13 02:01 5.9K 
[   ]datetimezone.getlocation.php2024-06-13 02:01 5.9K 
[   ]function.xdiff-file-bdiff.php2024-06-13 02:01 5.9K 
[   ]function.pcntl-setpriority.php2024-06-13 02:01 5.9K 
[   ]mysqli.next-result.php2024-06-13 02:01 5.9K 
[   ]function.restore-error-handler.php2024-06-13 02:01 5.9K 
[   ]memcached.deletemultibykey.php2024-06-13 02:01 5.9K 
[   ]class.domnodelist.php2024-06-13 02:01 5.9K 
[   ]class.ds-collection.php2024-06-13 02:01 5.9K 
[   ]vtiful-kernel-format.align.php2024-06-13 02:01 5.9K 
[   ]threaded.synchronized.php2024-06-13 02:01 5.9K 
[   ]imagick.getpixeliterator.php2024-06-13 02:01 5.9K 
[   ]function.array-count-values.php2024-06-13 02:01 5.9K 
[   ]imagickpixeliterator.construct.php2024-06-13 02:01 5.9K 
[   ]function.sha1.php2024-06-13 02:01 5.9K 
[   ]function.mailparse-stream-encode.php2024-06-13 02:01 5.9K 
[   ]splfileobject.fseek.php2024-06-13 02:01 5.9K 
[   ]function.cubrid-free-result.php2024-06-13 02:01 5.9K 
[   ]function.ldap-add-ext.php2024-06-13 02:01 5.9K 
[   ]function.fann-get-cascade-num-candidates.php2024-06-13 02:01 5.9K 
[   ]imagick.pingimageblob.php2024-06-13 02:01 5.9K 
[   ]function.msg-get-queue.php2024-06-13 02:01 5.9K 
[   ]function.ldap-mod_del-ext.php2024-06-13 02:01 5.9K 
[   ]function.quotemeta.php2024-06-13 02:01 5.9K 
[   ]function.ps-add-weblink.php2024-06-13 02:01 5.9K 
[   ]parle-rlexer.push.php2024-06-13 02:01 5.9K 
[   ]mysql-xdevapi-crudoperationlimitable.limit.php2024-06-13 02:01 5.9K 
[   ]function.gettext.php2024-06-13 02:01 5.9K 
[   ]threaded.wait.php2024-06-13 02:01 5.9K 
[   ]splfileinfo.getbasename.php2024-06-13 02:01 5.9K 
[   ]pool.submit.php2024-06-13 02:01 5.9K 
[   ]function.ldap-mod_add-ext.php2024-06-13 02:01 5.9K 
[   ]seaslog.closeloggerstream.php2024-06-13 02:01 5.9K 
[   ]function.imagecolordeallocate.php2024-06-13 02:01 5.9K 
[   ]mysql-xdevapi-table.getschema.php2024-06-13 02:01 5.9K 
[   ]mongodb-driver-manager.getreadconcern.php2024-06-13 02:01 5.9K 
[   ]image.installation.php2024-06-13 02:01 5.9K 
[   ]function.shell-exec.php2024-06-13 02:01 5.9K 
[   ]function.deflate-add.php2024-06-13 02:01 5.9K 
[   ]ds-map.intersect.php2024-06-13 02:01 5.9K 
[   ]function.pfsockopen.php2024-06-13 02:01 5.9K 
[   ]function.hash-update-file.php2024-06-13 02:01 5.9K 
[   ]function.filegroup.php2024-06-13 02:01 5.9K 
[   ]solrdismaxquery.removequeryfield.php2024-06-13 02:01 5.9K 
[   ]soapclient.setlocation.php2024-06-13 02:01 5.8K 
[   ]mongodb-driver-writeconcern.getwtimeout.php2024-06-13 02:01 5.8K 
[   ]function.imap-fetchheader.php2024-06-13 02:01 5.8K 
[   ]componere-definition.construct.php2024-06-13 02:01 5.8K 
[   ]php-user-filter.filter.php2024-06-13 02:01 5.8K 
[   ]function.lchown.php2024-06-13 02:01 5.8K 
[   ]ziparchive.addemptydir.php2024-06-13 02:01 5.8K 
[   ]language.errors.php7.php2024-06-13 02:01 5.8K 
[   ]intlcalendar.getactualminimum.php2024-06-13 02:01 5.8K 
[   ]intlchar.charage.php2024-06-13 02:01 5.8K 
[   ]regexiterator.getpregflags.php2024-06-13 02:01 5.8K 
[   ]function.ob-gzhandler.php2024-06-13 02:01 5.8K 
[   ]function.ldap-control-paged-result-response.php2024-06-13 02:01 5.8K 
[   ]function.pg-connection-reset.php2024-06-13 02:01 5.8K 
[   ]function.imagecolorstotal.php2024-06-13 02:01 5.8K 
[   ]ds-map.union.php2024-06-13 02:01 5.8K 
[   ]class.gmagickpixel.php2024-06-13 02:01 5.8K 
[   ]imagick.convolveimage.php2024-06-13 02:01 5.8K 
[   ]reflectiongenerator.getexecutinggenerator.php2024-06-13 02:01 5.8K 
[   ]function.imap-gc.php2024-06-13 02:01 5.8K 
[   ]splfileinfo.getpathinfo.php2024-06-13 02:01 5.8K 
[   ]function.dbase-get-record.php2024-06-13 02:01 5.8K 
[   ]function.mcrypt-generic.php2024-06-13 02:01 5.8K 
[   ]class.mongodb-bson-symbol.php2024-06-13 02:01 5.8K 
[   ]language.constants.magic.php2024-06-13 02:01 5.8K 
[   ]mysql-xdevapi-tableupdate.orderby.php2024-06-13 02:01 5.8K 
[   ]function.sodium-crypto-secretstream-xchacha20poly1305-push.php2024-06-13 02:01 5.8K 
[   ]ref.mcrypt.php2024-06-13 02:01 5.8K 
[   ]reflectiontype.allowsnull.php2024-06-13 02:01 5.8K 
[   ]intlchar.isalpha.php2024-06-13 02:01 5.8K 
[   ]eventbufferevent.sslsocket.php2024-06-13 02:01 5.8K 
[   ]mysql-xdevapi-table.getsession.php2024-06-13 02:01 5.8K 
[   ]imagick.evaluateimage.php2024-06-13 02:01 5.8K 
[   ]function.pspell-clear-session.php2024-06-13 02:01 5.8K 
[   ]function.pg-connection-busy.php2024-06-13 02:01 5.8K 
[   ]mysqlnd.plugin.mysql-proxy.php2024-06-13 02:01 5.8K 
[   ]function.xml-parser-get-option.php2024-06-13 02:01 5.8K 
[   ]eventbufferevent.sslerror.php2024-06-13 02:01 5.8K 
[   ]sqlite3.querysingle.php2024-06-13 02:01 5.8K 
[   ]mysql-xdevapi-tableselect.execute.php2024-06-13 02:01 5.8K 
[   ]function.mongodb.bson-fromjson.php2024-06-13 02:01 5.8K 
[   ]memcached.getdelayedbykey.php2024-06-13 02:01 5.8K 
[   ]reflectionclass.isinstance.php2024-06-13 02:01 5.8K 
[   ]class.ui-controls-progress.php2024-06-13 02:01 5.8K 
[   ]book.fdf.php2024-06-13 02:01 5.8K 
[   ]yaf-application.clearlasterror.php2024-06-13 02:01 5.8K 
[   ]threaded.notifyone.php2024-06-13 02:01 5.8K 
[   ]yaf-route-supervar.construct.php2024-06-13 02:01 5.8K 
[   ]simplexmlelement.getnamespaces.php2024-06-13 02:01 5.8K 
[   ]function.variant-mul.php2024-06-13 02:01 5.8K 
[   ]mongodb-bson-utcdatetime.todatetime.php2024-06-13 02:01 5.8K 
[   ]zookeeper.exists.php2024-06-13 02:01 5.8K 
[   ]function.pg-options.php2024-06-13 02:01 5.8K 
[   ]regexp.reference.subpatterns.php2024-06-13 02:01 5.8K 
[   ]reflectiontype.tostring.php2024-06-13 02:01 5.8K 
[   ]book.var.php2024-06-13 02:01 5.8K 
[   ]mysqli.init.php2024-06-13 02:01 5.8K 
[   ]function.ps-add-launchlink.php2024-06-13 02:01 5.8K 
[   ]function.openssl-pkcs12-read.php2024-06-13 02:01 5.8K 
[   ]function.gzdeflate.php2024-06-13 02:01 5.8K 
[   ]function.ibase-name-result.php2024-06-13 02:01 5.8K 
[   ]function.hash-algos.php2024-06-13 02:01 5.8K 
[   ]function.gmp-divexact.php2024-06-13 02:01 5.8K 
[   ]reflectionclass.getstaticpropertyvalue.php2024-06-13 02:01 5.8K 
[   ]function.db2-pclose.php2024-06-13 02:01 5.8K 
[   ]class.solrobject.php2024-06-13 02:01 5.8K 
[   ]function.win32-set-service-exit-code.php2024-06-13 02:01 5.8K 
[   ]mysql-xdevapi-table.getname.php2024-06-13 02:01 5.8K 
[   ]reflectionfunctionabstract.getclosureusedvariables.php2024-06-13 02:01 5.8K 
[   ]function.odbc-result.php2024-06-13 02:01 5.8K 
[   ]function.odbc-autocommit.php2024-06-13 02:01 5.8K 
[   ]soapserver.getfunctions.php2024-06-13 02:01 5.8K 
[   ]mysql-xdevapi-session.rollbackto.php2024-06-13 02:01 5.8K 
[   ]function.snmpget.php2024-06-13 02:01 5.8K 
[   ]function.cubrid-error-code-facility.php2024-06-13 02:01 5.8K 
[   ]cachingiterator.getcache.php2024-06-13 02:01 5.8K 
[   ]function.gnupg-setsignmode.php2024-06-13 02:01 5.8K 
[   ]class.mongodb-bson-maxkey.php2024-06-13 02:01 5.8K 
[   ]splfileobject.fwrite.php2024-06-13 02:01 5.8K 
[   ]eventhttprequest.senderror.php2024-06-13 02:01 5.8K 
[   ]tidy.props.errorbuffer.php2024-06-13 02:01 5.8K 
[   ]function.openssl-pkey-get-public.php2024-06-13 02:01 5.8K 
[   ]intltimezone.getidforwindowsid.php2024-06-13 02:01 5.8K 
[   ]imagick.getsize.php2024-06-13 02:01 5.8K 
[   ]datetimeimmutable.settimestamp.php2024-06-13 02:01 5.8K 
[   ]intltimezone.createtimezoneidenumeration.php2024-06-13 02:01 5.8K 
[   ]intlchar.enumchartypes.php2024-06-13 02:01 5.8K 
[   ]regexp.reference.internal-options.php2024-06-13 02:01 5.8K 
[   ]language.oop5.references.php2024-06-13 02:01 5.8K 
[   ]function.ob-end-clean.php2024-06-13 02:01 5.8K 
[   ]class.mongodb-bson-minkey.php2024-06-13 02:01 5.8K 
[   ]function.stream-set-write-buffer.php2024-06-13 02:01 5.8K 
[   ]class.stompexception.php2024-06-13 02:01 5.8K 
[   ]locale.getdefault.php2024-06-13 02:01 5.8K 
[   ]function.ps-show.php2024-06-13 02:01 5.8K 
[   ]function.ldap-count-entries.php2024-06-13 02:01 5.8K 
[   ]arrayobject.setiteratorclass.php2024-06-13 02:01 5.8K 
[   ]imagick.sketchimage.php2024-06-13 02:01 5.8K 
[   ]evperiodic.createstopped.php2024-06-13 02:01 5.8K 
[   ]syncmutex.construct.php2024-06-13 02:01 5.8K 
[   ]mongodb-driver-readconcern.getlevel.php2024-06-13 02:01 5.8K 
[   ]function.array-shift.php2024-06-13 02:01 5.8K 
[   ]function.apache-setenv.php2024-06-13 02:01 5.8K 
[   ]function.apache-lookup-uri.php2024-06-13 02:01 5.8K 
[   ]function.imagecreatefromwebp.php2024-06-13 02:01 5.7K 
[   ]mongodb-driver-writeerror.getmessage.php2024-06-13 02:01 5.7K 
[   ]vtiful-kernel-excel.addSheet.php2024-06-13 02:01 5.7K 
[   ]language.oop5.iterations.php2024-06-13 02:01 5.7K 
[   ]mongodb-bson-decimal128.construct.php2024-06-13 02:01 5.7K 
[   ]intlchar.ismirrored.php2024-06-13 02:01 5.7K 
[   ]function.pspell-config-ignore.php2024-06-13 02:01 5.7K 
[   ]function.gmp-powm.php2024-06-13 02:01 5.7K 
[   ]function.ngettext.php2024-06-13 02:01 5.7K 
[   ]domdocument.createattribute.php2024-06-13 02:01 5.7K 
[   ]function.cubrid-lob-size.php2024-06-13 02:01 5.7K 
[   ]function.iconv-get-encoding.php2024-06-13 02:01 5.7K 
[   ]function.is-iterable.php2024-06-13 02:01 5.7K 
[   ]class.mongodb-driver-monitoring-serverheartbeatsucceededevent.php2024-06-13 02:01 5.7K 
[   ]language.operators.arithmetic.php2024-06-13 02:01 5.7K 
[   ]book.snmp.php2024-06-13 02:01 5.7K 
[   ]class.variant.php2024-06-13 02:01 5.7K 
[   ]mysql-xdevapi-tableupdate.set.php2024-06-13 02:01 5.7K 
[   ]function.tcpwrap-check.php2024-06-13 02:01 5.7K 
[   ]ds-sequence.join.php2024-06-13 02:01 5.7K 
[   ]imagick.paintfloodfillimage.php2024-06-13 02:01 5.7K 
[   ]domdocument.createcomment.php2024-06-13 02:01 5.7K 
[   ]function.imap-renamemailbox.php2024-06-13 02:01 5.7K 
[   ]wincache.reroutes.php2024-06-13 02:01 5.7K 
[   ]migration70.deprecated.php2024-06-13 02:01 5.7K 
[   ]class.yar-client.php2024-06-13 02:01 5.7K 
[   ]xmlwriter.writedtdattlist.php2024-06-13 02:01 5.7K 
[   ]reflectionproperty.isdefault.php2024-06-13 02:01 5.7K 
[   ]memcached.replacebykey.php2024-06-13 02:01 5.7K 
[   ]function.filesize.php2024-06-13 02:01 5.7K 
[TXT]tidy.html.php2024-06-13 02:01 5.7K 
[   ]function.oci-register-taf-callback.php2024-06-13 02:01 5.7K 
[   ]function.imap-body.php2024-06-13 02:01 5.7K 
[   ]mysql-xdevapi-crudoperationbindable.bind.php2024-06-13 02:01 5.7K 
[   ]function.sodium-crypto-secretstream-xchacha20poly1305-pull.php2024-06-13 02:01 5.7K 
[   ]function.bcadd.php2024-06-13 02:01 5.7K 
[   ]domdocument.createtextnode.php2024-06-13 02:01 5.7K 
[   ]imagick.rotationalblurimage.php2024-06-13 02:01 5.7K 
[   ]function.apache-request-headers.php2024-06-13 02:01 5.7K 
[   ]class.sqlite3result.php2024-06-13 02:01 5.7K 
[   ]pgsql.configuration.php2024-06-13 02:01 5.7K 
[   ]image.examples-watermark.php2024-06-13 02:01 5.7K 
[   ]reflectionclass.getconstant.php2024-06-13 02:01 5.7K 
[   ]function.gnupg-setarmor.php2024-06-13 02:01 5.7K 
[   ]imagick.getimageproperties.php2024-06-13 02:01 5.7K 
[   ]imagick.newpseudoimage.php2024-06-13 02:01 5.7K 
[   ]imagick.spliceimage.php2024-06-13 02:01 5.7K 
[   ]imagick.pingimagefile.php2024-06-13 02:01 5.7K 
[   ]function.gnupg-seterrormode.php2024-06-13 02:01 5.7K 
[   ]function.imap-setacl.php2024-06-13 02:01 5.7K 
[   ]xmlwriter.writedtdelement.php2024-06-13 02:01 5.7K 
[   ]tidy.body.php2024-06-13 02:01 5.7K 
[   ]function.mb-ereg-search-regs.php2024-06-13 02:01 5.7K 
[   ]function.gnupg-geterrorinfo.php2024-06-13 02:01 5.7K 
[   ]function.bccomp.php2024-06-13 02:01 5.7K 
[   ]function.is-link.php2024-06-13 02:01 5.7K 
[   ]function.gzopen.php2024-06-13 02:01 5.7K 
[   ]function.sodium-crypto-core-ristretto255-scalar-random.php2024-06-13 02:01 5.7K 
[   ]function.apcu-fetch.php2024-06-13 02:01 5.7K 
[   ]imagick.smushimages.php2024-06-13 02:01 5.7K 
[   ]function.ssh2-sftp-symlink.php2024-06-13 02:01 5.7K 
[   ]mysql-xdevapi-table.count.php2024-06-13 02:01 5.7K 
[   ]function.uopz-set-static.php2024-06-13 02:01 5.7K 
[   ]function.gmp-prob-prime.php2024-06-13 02:01 5.7K 
[   ]function.fsync.php2024-06-13 02:01 5.7K 
[   ]function.eio-event-loop.php2024-06-13 02:01 5.7K 
[   ]function.sha1-file.php2024-06-13 02:01 5.7K 
[   ]function.snmp2-get.php2024-06-13 02:01 5.7K 
[   ]function.is-array.php2024-06-13 02:01 5.7K 
[   ]mysql-xdevapi-schema.getcollection.php2024-06-13 02:01 5.7K 
[   ]intlcalendar.gettype.php2024-06-13 02:01 5.7K 
[   ]function.variant-idiv.php2024-06-13 02:01 5.7K 
[   ]function.odbc-connection-string-quote.php2024-06-13 02:01 5.7K 
[   ]function.bcsub.php2024-06-13 02:01 5.7K 
[   ]datetime.setisodate.php2024-06-13 02:01 5.7K 
[   ]directoryiterator.construct.php2024-06-13 02:01 5.7K 
[   ]ref.pdo-ibm.connection.php2024-06-13 02:01 5.7K 
[   ]function.umask.php2024-06-13 02:01 5.7K 
[   ]function.gmp-pow.php2024-06-13 02:01 5.7K 
[   ]rararchive.getcomment.php2024-06-13 02:01 5.7K 
[   ]memcached.getstats.php2024-06-13 02:01 5.7K 
[   ]eventbase.getfeatures.php2024-06-13 02:01 5.7K 
[   ]class.mongodb-driver-monitoring-serverchangedevent.php2024-06-13 02:01 5.7K 
[   ]splfileobject.current.php2024-06-13 02:01 5.7K 
[   ]pgsql.examples-queries.php2024-06-13 02:01 5.7K 
[   ]class.mongodb-driver-monitoring-serverheartbeatfailedevent.php2024-06-13 02:01 5.7K 
[   ]ds-vector.join.php2024-06-13 02:01 5.7K 
[   ]reflectionenum.getcases.php2024-06-13 02:01 5.7K 
[   ]mongodb-driver-readconcern.construct.php2024-06-13 02:01 5.7K 
[   ]imagick.mattefloodfillimage.php2024-06-13 02:01 5.7K 
[   ]stomp.send.php2024-06-13 02:01 5.7K 
[   ]function.enchant-broker-dict-exists.php2024-06-13 02:01 5.7K 
[   ]memcached.getmultibykey.php2024-06-13 02:01 5.7K 
[   ]function.cubrid-error-code.php2024-06-13 02:01 5.7K 
[   ]yaf-response-abstract.appendbody.php2024-06-13 02:01 5.7K 
[   ]splobjectstorage.valid.php2024-06-13 02:01 5.7K 
[   ]function.openssl-cms-decrypt.php2024-06-13 02:01 5.7K 
[   ]function.fileowner.php2024-06-13 02:01 5.7K 
[   ]function.ob-end-flush.php2024-06-13 02:01 5.7K 
[   ]function.geoip-continent-code-by-name.php2024-06-13 02:01 5.7K 
[   ]directoryiterator.valid.php2024-06-13 02:01 5.7K 
[   ]domnode.c14nfile.php2024-06-13 02:01 5.6K 
[   ]reflectiongenerator.construct.php2024-06-13 02:01 5.6K 
[   ]eventutil.setsocketoption.php2024-06-13 02:01 5.6K 
[   ]refs.ui.php2024-06-13 02:01 5.6K 
[   ]ds-map.merge.php2024-06-13 02:01 5.6K 
[   ]limititerator.getposition.php2024-06-13 02:01 5.6K 
[   ]imagick.blurimage.php2024-06-13 02:01 5.6K 
[   ]function.date-default-timezone-set.php2024-06-13 02:01 5.6K 
[   ]tidy.head.php2024-06-13 02:01 5.6K 
[   ]solrquery.addgroupfield.php2024-06-13 02:01 5.6K 
[   ]function.mhash-keygen-s2k.php2024-06-13 02:01 5.6K 
[   ]function.mb-ereg-search.php2024-06-13 02:01 5.6K 
[   ]function.array-pop.php2024-06-13 02:01 5.6K 
[   ]memcached.deletebykey.php2024-06-13 02:01 5.6K 
[   ]migration70.changed-functions.php2024-06-13 02:01 5.6K 
[   ]ds-deque.join.php2024-06-13 02:01 5.6K 
[   ]yaf-application.getlasterrormsg.php2024-06-13 02:01 5.6K 
[   ]memcached.addbykey.php2024-06-13 02:01 5.6K 
[   ]xmlwriter.startdtdentity.php2024-06-13 02:01 5.6K 
[   ]ds-map.sum.php2024-06-13 02:01 5.6K 
[   ]quickhashinthash.update.php2024-06-13 02:01 5.6K 
[   ]mongodb-driver-clientencryption.removekeyaltname.php2024-06-13 02:01 5.6K 
[   ]phardata.setsignaturealgorithm.php2024-06-13 02:01 5.6K 
[   ]function.array-product.php2024-06-13 02:01 5.6K 
[   ]splfileobject.ftruncate.php2024-06-13 02:01 5.6K 
[   ]function.eio-dup2.php2024-06-13 02:01 5.6K 
[   ]ziparchive.statindex.php2024-06-13 02:01 5.6K 
[   ]ref.network.php2024-06-13 02:01 5.6K 
[   ]phar.delete.php2024-06-13 02:01 5.6K 
[   ]function.getimagesizefromstring.php2024-06-13 02:01 5.6K 
[   ]memcached.delete.php2024-06-13 02:01 5.6K 
[   ]yar-server-exception.gettype.php2024-06-13 02:01 5.6K 
[   ]soap.configuration.php2024-06-13 02:01 5.6K 
[   ]intlchar.isisocontrol.php2024-06-13 02:01 5.6K 
[   ]mysql-xdevapi-tableselect.limit.php2024-06-13 02:01 5.6K 
[   ]pool.construct.php2024-06-13 02:01 5.6K 
[   ]imagick.trimimage.php2024-06-13 02:01 5.6K 
[   ]function.cubrid-num-fields.php2024-06-13 02:01 5.6K 
[   ]xmlwriter.writepi.php2024-06-13 02:01 5.6K 
[   ]intlchar.getnumericvalue.php2024-06-13 02:01 5.6K 
[   ]imagick.transformimagecolorspace.php2024-06-13 02:01 5.6K 
[   ]function.pcntl-signal-dispatch.php2024-06-13 02:01 5.6K 
[   ]function.eio-fstatvfs.php2024-06-13 02:01 5.6K 
[   ]oauthprovider.consumerhandler.php2024-06-13 02:01 5.6K 
[   ]mongodb-driver-writeerror.getcode.php2024-06-13 02:01 5.6K 
[   ]function.ldap-get-values-len.php2024-06-13 02:01 5.6K 
[   ]quickhashintstringhash.get.php2024-06-13 02:01 5.6K 
[   ]mysql-xdevapi-session.releasesavepoint.php2024-06-13 02:01 5.6K 
[   ]install.php2024-06-13 02:01 5.6K 
[   ]function.mailparse-rfc822-parse-addresses.php2024-06-13 02:01 5.6K 
[   ]memcached.construct.php2024-06-13 02:01 5.6K 
[   ]function.checkdate.php2024-06-13 02:01 5.6K 
[   ]function.chdir.php2024-06-13 02:01 5.6K 
[   ]regexiterator.getflags.php2024-06-13 02:01 5.6K 
[   ]domchildnode.after.php2024-06-13 02:01 5.6K 
[   ]function.yaz-ccl-conf.php2024-06-13 02:01 5.6K 
[   ]class.weakreference.php2024-06-13 02:01 5.6K 
[   ]book.parallel.php2024-06-13 02:01 5.6K 
[   ]function.uopz-set-hook.php2024-06-13 02:01 5.6K 
[   ]imagickdraw.pathellipticarcabsolute.php2024-06-13 02:01 5.6K 
[   ]intlchar.chr.php2024-06-13 02:01 5.6K 
[   ]function.gmp-export.php2024-06-13 02:01 5.6K 
[   ]function.xml-set-character-data-handler.php2024-06-13 02:01 5.6K 
[   ]imagick.gammaimage.php2024-06-13 02:01 5.6K 
[   ]locale.getscript.php2024-06-13 02:01 5.6K 
[   ]function.radius-put-addr.php2024-06-13 02:01 5.6K 
[   ]reflectionextension.getconstants.php2024-06-13 02:01 5.6K 
[   ]function.imagecreatefrombmp.php2024-06-13 02:01 5.6K 
[   ]function.gmp-legendre.php2024-06-13 02:01 5.6K 
[   ]phar.addemptydir.php2024-06-13 02:01 5.6K 
[   ]function.mqseries-disc.php2024-06-13 02:01 5.6K 
[   ]function.bindtextdomain.php2024-06-13 02:01 5.6K 
[   ]domnode.replacechild.php2024-06-13 02:01 5.6K 
[   ]function.gnupg-getengineinfo.php2024-06-13 02:01 5.6K 
[   ]datetimeimmutable.getlasterrors.php2024-06-13 02:01 5.6K 
[   ]function.imagecreatefromxbm.php2024-06-13 02:01 5.6K 
[   ]function.eio-fsync.php2024-06-13 02:01 5.6K 
[   ]function.fflush.php2024-06-13 02:01 5.6K 
[   ]function.symlink.php2024-06-13 02:01 5.6K 
[   ]function.com-get-active-object.php2024-06-13 02:01 5.6K 
[   ]phar.hasmetadata.php2024-06-13 02:01 5.6K 
[   ]function.sodium-crypto-core-ristretto255-is-valid-point.php2024-06-13 02:01 5.6K 
[   ]yaf-application.getdispatcher.php2024-06-13 02:01 5.6K 
[   ]phptoken.gettokenname.php2024-06-13 02:01 5.6K 
[   ]function.ftp-raw.php2024-06-13 02:01 5.6K 
[   ]ds-set.join.php2024-06-13 02:01 5.6K 
[   ]function.db2-close.php2024-06-13 02:01 5.6K 
[   ]zmqcontext.construct.php2024-06-13 02:01 5.6K 
[   ]function.gmp-jacobi.php2024-06-13 02:01 5.6K 
[   ]wrappers.compression.php2024-06-13 02:01 5.6K 
[   ]function.enchant-broker-set-dict-path.php2024-06-13 02:01 5.6K 
[   ]event.callbacks.php2024-06-13 02:01 5.6K 
[   ]imagick.rotateimage.php2024-06-13 02:01 5.6K 
[   ]imagick.linearstretchimage.php2024-06-13 02:01 5.6K 
[   ]imagickdraw.pathellipticarcrelative.php2024-06-13 02:01 5.6K 
[   ]function.eio-close.php2024-06-13 02:01 5.6K 
[   ]function.fann-get-activation-steepness.php2024-06-13 02:01 5.6K 
[   ]url.constants.php2024-06-13 02:01 5.6K 
[   ]splobjectstorage.contains.php2024-06-13 02:01 5.6K 
[   ]solrquery.setgroupmain.php2024-06-13 02:01 5.6K 
[   ]simplexmlelement.key.php2024-06-13 02:01 5.6K 
[   ]function.ldap-exop-sync.php2024-06-13 02:01 5.6K 
[   ]yaf-response-abstract.prependbody.php2024-06-13 02:01 5.6K 
[   ]solrdismaxquery.addqueryfield.php2024-06-13 02:01 5.6K 
[   ]intlchar.getblockcode.php2024-06-13 02:01 5.6K 
[   ]function.get-extension-funcs.php2024-06-13 02:01 5.6K 
[   ]function.radius-cvt-string.php2024-06-13 02:01 5.6K 
[   ]mongodb-driver-clientencryption.addkeyaltname.php2024-06-13 02:01 5.6K 
[   ]intlgregoriancalendar.construct.php2024-06-13 02:01 5.6K 
[   ]function.eio-poll.php2024-06-13 02:01 5.6K 
[   ]domdocument.createdocumentfragment.php2024-06-13 02:01 5.6K 
[   ]function.pg-connection-status.php2024-06-13 02:01 5.6K 
[   ]imagick.brightnesscontrastimage.php2024-06-13 02:01 5.6K 
[   ]ref.ftp.php2024-06-13 02:01 5.6K 
[   ]function.fann-set-callback.php2024-06-13 02:01 5.6K 
[   ]ds-map.apply.php2024-06-13 02:01 5.6K 
[   ]ref.pdo-oci.php2024-06-13 02:01 5.6K 
[   ]function.extension-loaded.php2024-06-13 02:01 5.6K 
[   ]threaded.notify.php2024-06-13 02:01 5.6K 
[   ]imagick.shadeimage.php2024-06-13 02:01 5.6K 
[   ]function.mb-ereg-match.php2024-06-13 02:01 5.6K 
[   ]recursiveregexiterator.haschildren.php2024-06-13 02:01 5.6K 
[   ]generator.send.php2024-06-13 02:01 5.6K 
[   ]function.disk-free-space.php2024-06-13 02:01 5.6K 
[   ]function.radius-put-vendor-addr.php2024-06-13 02:01 5.6K 
[   ]xmlreader.isvalid.php2024-06-13 02:01 5.6K 
[   ]function.gmp-cmp.php2024-06-13 02:01 5.6K 
[   ]imagick.addnoiseimage.php2024-06-13 02:01 5.5K 
[   ]function.openal-source-get.php2024-06-13 02:01 5.5K 
[   ]datetime.setdate.php2024-06-13 02:01 5.5K 
[   ]shmop.examples-basic.php2024-06-13 02:01 5.5K 
[   ]reflectionclass.tostring.php2024-06-13 02:01 5.5K 
[   ]imagick.compareimages.php2024-06-13 02:01 5.5K 
[   ]function.get-loaded-extensions.php2024-06-13 02:01 5.5K 
[   ]function.bcscale.php2024-06-13 02:01 5.5K 
[   ]mongodb-bson-objectid.gettimestamp.php2024-06-13 02:01 5.5K 
[   ]quickhashintset.delete.php2024-06-13 02:01 5.5K 
[   ]luasandbox.loadstring.php2024-06-13 02:01 5.5K 
[   ]function.sodium-crypto-core-ristretto255-random.php2024-06-13 02:01 5.5K 
[   ]imagick.posterizeimage.php2024-06-13 02:01 5.5K 
[   ]function.gmp-init.php2024-06-13 02:01 5.5K 
[   ]class.directory.php2024-06-13 02:01 5.5K 
[   ]class.libxmlerror.php2024-06-13 02:01 5.5K 
[   ]function.pspell-suggest.php2024-06-13 02:01 5.5K 
[   ]class.curlstringfile.php2024-06-13 02:01 5.5K 
[   ]book.ffi.php2024-06-13 02:01 5.5K 
[   ]function.fdf-save-string.php2024-06-13 02:01 5.5K 
[   ]function.dba-handlers.php2024-06-13 02:01 5.5K 
[   ]book.simplexml.php2024-06-13 02:01 5.5K 
[   ]imagick.resampleimage.php2024-06-13 02:01 5.5K 
[   ]imagick.modulateimage.php2024-06-13 02:01 5.5K 
[   ]function.ldap-delete.php2024-06-13 02:01 5.5K 
[   ]function.escapeshellarg.php2024-06-13 02:01 5.5K 
[   ]function.gzinflate.php2024-06-13 02:01 5.5K 
[   ]function.gmp-perfect-square.php2024-06-13 02:01 5.5K 
[   ]function.sqlsrv-close.php2024-06-13 02:01 5.5K 
[   ]function.ldap-first-attribute.php2024-06-13 02:01 5.5K 
[   ]splfileinfo.setfileclass.php2024-06-13 02:01 5.5K 
[   ]mongodb-bson-document.tophp.php2024-06-13 02:01 5.5K 
[   ]function.posix-setuid.php2024-06-13 02:01 5.5K 
[   ]function.radius-cvt-int.php2024-06-13 02:01 5.5K 
[   ]random-engine-secure.generate.php2024-06-13 02:01 5.5K 
[   ]mongodb-driver-session.committransaction.php2024-06-13 02:01 5.5K 
[   ]imagick.sharpenimage.php2024-06-13 02:01 5.5K 
[   ]function.xml-set-default-handler.php2024-06-13 02:01 5.5K 
[   ]function.is-bool.php2024-06-13 02:01 5.5K 
[   ]intlchar.chardigitvalue.php2024-06-13 02:01 5.5K 
[   ]simplexmlelement.haschildren.php2024-06-13 02:01 5.5K 
[   ]function.grapheme-strlen.php2024-06-13 02:01 5.5K 
[   ]function.ftp-systype.php2024-06-13 02:01 5.5K 
[   ]function.abs.php2024-06-13 02:01 5.5K 
[   ]function.ssh2-sftp-rename.php2024-06-13 02:01 5.5K 
[   ]function.memory-get-usage.php2024-06-13 02:01 5.5K 
[   ]function.hash-copy.php2024-06-13 02:01 5.5K 
[   ]zlib.configuration.php2024-06-13 02:01 5.5K 
[   ]mysql-xdevapi-collection.getsession.php2024-06-13 02:01 5.5K 
[   ]class.ui-draw-matrix.php2024-06-13 02:01 5.5K 
[   ]function.gnupg-listsignatures.php2024-06-13 02:01 5.5K 
[   ]splfixedarray.setsize.php2024-06-13 02:01 5.5K 
[   ]mongodb.exceptions.tree.php2024-06-13 02:01 5.5K 
[   ]function.fann-cascadetrain-on-file.php2024-06-13 02:01 5.5K 
[   ]collator.construct.php2024-06-13 02:01 5.5K 
[   ]reflectionenum.hascase.php2024-06-13 02:01 5.5K 
[   ]function.uopz-unset-hook.php2024-06-13 02:01 5.5K 
[   ]class.zmqcontext.php2024-06-13 02:01 5.5K 
[   ]intltimezone.getdisplayname.php2024-06-13 02:01 5.5K 
[   ]gearmanworker.work.php2024-06-13 02:01 5.5K 
[   ]function.yaz-sort.php2024-06-13 02:01 5.5K 
[   ]random-randomizer.nextint.php2024-06-13 02:01 5.5K 
[   ]ds-priorityqueue.push.php2024-06-13 02:01 5.5K 
[   ]function.imap-rfc822-write-address.php2024-06-13 02:01 5.5K 
[   ]function.ssh2-sftp-realpath.php2024-06-13 02:01 5.5K 
[   ]function.lcg-value.php2024-06-13 02:01 5.5K 
[   ]function.eio-fdatasync.php2024-06-13 02:01 5.5K 
[   ]function.ssh2-sftp-rmdir.php2024-06-13 02:01 5.5K 
[   ]function.gmp-scan1.php2024-06-13 02:01 5.5K 
[   ]mongodb-driver-manager.addsubscriber.php2024-06-13 02:01 5.5K 
[   ]splfixedarray.construct.php2024-06-13 02:01 5.5K 
[   ]splfileinfo.getfilename.php2024-06-13 02:01 5.5K 
[   ]function.fann-set-scaling-params.php2024-06-13 02:01 5.5K 
[   ]function.tmpfile.php2024-06-13 02:01 5.5K 
[   ]function.fdf-add-doc-javascript.php2024-06-13 02:01 5.5K 
[   ]book.wincache.php2024-06-13 02:01 5.5K 
[   ]reflectionfunctionabstract.isclosure.php2024-06-13 02:01 5.5K 
[   ]function.cli-set-process-title.php2024-06-13 02:01 5.5K 
[   ]wddx.examples-serialize.php2024-06-13 02:01 5.5K 
[   ]imagick.queryfontmetrics.php2024-06-13 02:01 5.5K 
[   ]function.gmp-scan0.php2024-06-13 02:01 5.5K 
[   ]varnish.example.admin.php2024-06-13 02:01 5.5K 
[   ]function.session-get-cookie-params.php2024-06-13 02:01 5.5K 
[   ]filter.examples.sanitization.php2024-06-13 02:01 5.5K 
[   ]domattr.construct.php2024-06-13 02:01 5.5K 
[   ]function.enum-exists.php2024-06-13 02:01 5.5K 
[   ]phar.interceptfilefuncs.php2024-06-13 02:01 5.5K 
[   ]domdocumentfragment.appendxml.php2024-06-13 02:01 5.5K 
[   ]sessionhandler.write.php2024-06-13 02:01 5.5K 
[   ]seekableiterator.seek.php2024-06-13 02:01 5.5K 
[   ]language.types.object.php2024-06-13 02:01 5.5K 
[   ]wrappers.data.php2024-06-13 02:01 5.5K 
[   ]function.shm-put-var.php2024-06-13 02:01 5.5K 
[   ]function.gnupg-import.php2024-06-13 02:01 5.5K 
[   ]mysqlinfo.library.choosing.php2024-06-13 02:01 5.5K 
[   ]luasandbox.setmemorylimit.php2024-06-13 02:01 5.5K 
[   ]class.mongodb-driver-cursorid.php2024-06-13 02:01 5.5K 
[   ]mongodb-driver-server.getport.php2024-06-13 02:01 5.5K 
[   ]intlchar.ord.php2024-06-13 02:01 5.5K 
[   ]book.misc.php2024-06-13 02:01 5.5K 
[   ]function.virtual.php2024-06-13 02:01 5.5K 
[   ]function.convert-uuencode.php2024-06-13 02:01 5.5K 
[   ]function.ftp-nb-continue.php2024-06-13 02:01 5.5K 
[   ]mysql-xdevapi-session.quotename.php2024-06-13 02:01 5.5K 
[   ]function.stream-context-set-option.php2024-06-13 02:01 5.5K 
[   ]imagick.negateimage.php2024-06-13 02:01 5.5K 
[   ]features.file-upload.put-method.php2024-06-13 02:01 5.5K 
[   ]mongodb-bson-utcdatetime.jsonserialize.php2024-06-13 02:01 5.5K 
[   ]book.luasandbox.php2024-06-13 02:01 5.5K 
[   ]xmlwriter.setindentstring.php2024-06-13 02:01 5.5K 
[   ]vtiful-kernel-format.italic.php2024-06-13 02:01 5.5K 
[   ]function.geoip-id-by-name.php2024-06-13 02:01 5.5K 
[   ]function.stream-context-get-params.php2024-06-13 02:01 5.5K 
[   ]class.yaf-bootstrap-abstract.php2024-06-13 02:01 5.5K 
[   ]function.getcwd.php2024-06-13 02:01 5.4K 
[   ]function.fann-create-sparse.php2024-06-13 02:01 5.4K 
[   ]function.ssh2-fetch-stream.php2024-06-13 02:01 5.4K 
[   ]mysql-xdevapi-schema.construct.php2024-06-13 02:01 5.4K 
[   ]install.windows.manual.php2024-06-13 02:01 5.4K 
[   ]splfileobject.getflags.php2024-06-13 02:01 5.4K 
[   ]function.ssh2-fingerprint.php2024-06-13 02:01 5.4K 
[   ]solrquery.setgroupformat.php2024-06-13 02:01 5.4K 
[   ]function.interface-exists.php2024-06-13 02:01 5.4K 
[   ]imagick.uniqueimagecolors.php2024-06-13 02:01 5.4K 
[   ]function.posix-ttyname.php2024-06-13 02:01 5.4K